Overview

  • Product name
    Recombinant Human Dab1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSTETELQVAVKTSAKKDSRKKGQDRSEATLIKRFKGEGVRYKAKLIGID EVSAARGDKLCQDSMMKLKGVVAGARSKGEHKQKIFLTISFGGIKIFDEK TGALQHHHAVHEISYIAKDITDHRAFGYVCGKEGNHRFVAIKTAQAAEPV ILDLRDLFQLIYELKQREELEKKAQKDKQCEQAVYQVPTSQKKEGVYDVP KSQPVSNGYSFEDFEERFAAATPNRNLPTDFDEIFEATKAVTQLELFGDM STPPDITSPPTPATPGDAFIPSSSQTLPASADVFSSVPFGTAAVPSGYVA MGAVLPSFWGQQPLVQQQMVMGAQPPVAQVMPGAQPIAWGQPGLFPATQQ PWPTVAGQFPPAAFMPTQTVMPLPAAMFQGPLTPLATVPGTSDSTRSSPQ TDKPRQKMGKETFKDFQMAQPPPVPSRKPDQPSLTCTSEAFSSYFNKVGV AQDTDDCDDFDISQLNLTPVTSTTPSTNSPPTPAPRQSSPSKSSASHASD PTTDDIFEEGFESPSKSEEQEAPDGSQASSNSDPFGEPSGEPSGDNISPQ AGS
    • Molecular weight
      86 kDa including tags
    • Amino acids
      1 to 553

Associated products

Specifications

Our Abpromise guarantee covers the use of ab152323 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Dab 1
    • Dab reelin signal transducer 1
    • Dab, reelin signal transducer, homolog 1 (Drosophila)
    • Dab1
    • DAB1_HUMAN
    • Disabled homolog 1
    • Disabled homolog 1 Drosophila
    • Scm
    • Scr
    • Scrambler
    • Yot
    • Yotari
    see all
  • Function
    Adapter molecule functioning in neural development. May regulate SIAH1 activity.
  • Sequence similarities
    Contains 1 PID domain.
  • Domain
    The PID domain specifically binds to the Asn-Pro-Xaa-Tyr(P) motif found in many tyrosine-phosphorylated proteins.
  • Post-translational
    modifications
    Phosphorylated on Tyr-198 and Tyr-220 upon reelin induction in embryonic neurons (By similarity). Also phosphorylated on Ser-524 independently of reelin signaling.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152323 stained with Coomassie Blue.

References

ab152323 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152323.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up