Overview

  • Product nameRecombinant Human DACH1 protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ9UI36-2
    • SpeciesHuman
    • SequenceTELKMDFLRERELRETLEKQLAMEQKNRAIVQKRLKKEKKAKRKLQEALE FETKRREQAEQTLKQAASTDSLRVLNDSLTPEIEADRSGGRTDAERTIQD GRLYLKTTV
    • Molecular weight38 kDa including tags
    • Amino acids596 to 704

Specifications

Our Abpromise guarantee covers the use of ab114777 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DACH
    • Dach1
    • DACH1_HUMAN
    • Dachshund homolog 1
    • dachshund homolog 1 (Drosophila)
    • Dachsund homolog 1
    • FLJ10138
    • OTTHUMP00000018494
    see all
  • FunctionTranscription factor that is involved in regulation of organogenesis. Seems to be a regulator of SIX1, SIX6 and probably SIX5. Corepression of precursor cell proliferation in myoblasts by SIX1 is switched to coactivation through recruitment of EYA3 to the SIX1-DACH1 complex. Transcriptional activation seems also to involve association of CREBBP. Seems to act as a corepressor of SIX6 in regulating proliferation by directly repressing cyclin-dependent kinase inhibitors, including the p27Kip1 promoter (By similarity). Inhibits TGF-beta signaling through interaction with SMAD4 and NCOR1. Binds to chromatin DNA via its DACHbox-N domain.
  • Tissue specificityWidely expressed. Isoform 2 is found in brain, heart, kidney, liver, leukocytes and spleen. Isoform 3 is found in liver and heart. Isoform 4 is found in spleen.
  • Sequence similaritiesBelongs to the DACH/dachshund family.
  • DomainThe DACHbox-N/DD1 domain forms a structure containing a DNA binding motif similar to that of the forkhead/winged helix domain.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human DACH1 protein images

  • ab114777 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human DACH1 protein (ab114777)

ab114777 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114777.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"