Overview

  • Product name
    Recombinant Human DACH1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      TELKMDFLRERELRETLEKQLAMEQKNRAIVQKRLKKEKKAKRKLQEALE FETKRREQAEQTLKQAASTDSLRVLNDSLTPEIEADRSGGRTDAERTIQD GRLYLKTTV
    • Molecular weight
      38 kDa including tags
    • Amino acids
      596 to 704

Specifications

Our Abpromise guarantee covers the use of ab114777 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DACH
    • Dach1
    • DACH1_HUMAN
    • Dachshund family transcription factor 1
    • Dachshund homolog 1
    • dachshund homolog 1 (Drosophila)
    • Dachsund homolog 1
    • FLJ10138
    • OTTHUMP00000018494
    see all
  • Function
    Transcription factor that is involved in regulation of organogenesis. Seems to be a regulator of SIX1, SIX6 and probably SIX5. Corepression of precursor cell proliferation in myoblasts by SIX1 is switched to coactivation through recruitment of EYA3 to the SIX1-DACH1 complex. Transcriptional activation seems also to involve association of CREBBP. Seems to act as a corepressor of SIX6 in regulating proliferation by directly repressing cyclin-dependent kinase inhibitors, including the p27Kip1 promoter (By similarity). Inhibits TGF-beta signaling through interaction with SMAD4 and NCOR1. Binds to chromatin DNA via its DACHbox-N domain.
  • Tissue specificity
    Widely expressed. Isoform 2 is found in brain, heart, kidney, liver, leukocytes and spleen. Isoform 3 is found in liver and heart. Isoform 4 is found in spleen.
  • Sequence similarities
    Belongs to the DACH/dachshund family.
  • Domain
    The DACHbox-N/DD1 domain forms a structure containing a DNA binding motif similar to that of the forkhead/winged helix domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab114777 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References

ab114777 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114777.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up