Recombinant Human Dact1 / Dapper homolog 1 protein (ab153345)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      VVDTSEDEQSNYTTNCFGDSESSVSEGEFVGESTTTSDSEESGGLIWSQF VQTLPIQTVTAPDLHNHPAKTFVKIKASHNLKKKILRFRSGSLKLMTTV
    • Amino acids
      738 to 836
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153345 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Dact
    • dact1
    • DACT1_HUMAN
    • Dapper
    • Dapper antagonist of beta catenin homolog 1
    • Dapper antagonist of catenin 1
    • Dapper homolog 1
    • DAPPER1
    • Dpr
    • Dpr1
    • Frd
    • Frodo
    • hDPR1
    • Hepatocellular carcinoma novel gene 3 protein
    • Heptacellular carcinoma novel gene 3
    • HNG3
    • MTNG3
    • Thyex3
    see all
  • Function
    Positively regulates DVL2-mediated signaling pathways during development. Binds to DVL2 and impedes the degradation of CTNNB1/beta-catenin, thereby enhancing the transcriptional activation of target genes of the Wnt signaling pathway.
  • Sequence similarities
    Belongs to the dapper family.
  • Domain
    The C-terminal PDZ-binding motif mediates interaction with the PDZ domains of DSH (Dishevelled) family proteins.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • ab153345 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153345 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153345.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up