Overview

  • Product name
    Recombinant Human DAD1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSASVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFGYCLLVGT FPFNSFLSGFISCVGSFILAVCLRIQINPQNKADFQGISPERAFADFLFA STILHLVVMNFVG
    • Molecular weight
      38 kDa including tags
    • Amino acids
      1 to 113

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114803 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/ul.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DAD 1
    • DAD-1
    • dad1
    • DAD1_HUMAN
    • Defender against cell death 1
    • Dolichyl diphosphooligosaccharide protein glycosyltransferase subunit DAD1
    • Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1
    • Oligosaccharyl transferase subunit DAD1
    • OST 2
    • OST2
    see all
  • Function
    Component of the N-oligosaccharyl transferase enzyme which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). Loss of the DAD1 protein triggers apoptosis.
  • Sequence similarities
    Belongs to the DAD/OST2 family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab114803 on 12.5% SDS-PAGE Stained with Coomassie Blue.

References

ab114803 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114803.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up