Overview

  • Product nameRecombinant Human DAD1 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP61803
    • SpeciesHuman
    • SequenceMSASVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFGYCLLVGT FPFNSFLSGFISCVGSFILAVCLRIQINPQNKADFQGISPERAFADFLFA STILHLVVMNFVG
    • Molecular weight38 kDa including tags
    • Amino acids1 to 113

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114803 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 µg/ul.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DAD 1
    • DAD-1
    • dad1
    • DAD1_HUMAN
    • Defender against cell death 1
    • Dolichyl diphosphooligosaccharide protein glycosyltransferase subunit DAD1
    • Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1
    • Oligosaccharyl transferase subunit DAD1
    • OST 2
    • OST2
    see all
  • FunctionComponent of the N-oligosaccharyl transferase enzyme which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). Loss of the DAD1 protein triggers apoptosis.
  • Sequence similaritiesBelongs to the DAD/OST2 family.
  • Cellular localizationMembrane.
  • Information by UniProt

Recombinant Human DAD1 protein images

  • ab114803 on 12.5% SDS-PAGE Stained with Coomassie Blue.

References for Recombinant Human DAD1 protein (ab114803)

ab114803 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114803.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"