Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MTSKKLVNSVAGCADDALAGLVACNPNLQLLQGHRVALRSDLDSLKGRVA LLSGGGSGHEPAHAGFIGKGMLTGVIAGAVFTSPAVGSILAAIRAVAQAG TVGTLLIVKNYTGDRLNFGLAREQARAEGIPVEMVVIGDDSAFTVLKKAG RRGLCGTVLIHKVAGALAEAGVGLEEIAKQVNVVAKAMGTLGVSLSSCSV PGSKPTFELSADEVELGLGIHGEAGVRRIKMATADEIVKLMLDHMTNTTN ASHVPVQPGSSVVMMVNNLGGLSFLELGIIADATVRSLEGRGVKIARALV GTFMSALEMPGISLTLLLVDEPLLKLIDAETTAAAWPNVAAVSITGRKRS RVAPAEPQEAPDSTAAGGSASKRMALVLERACSTLLGLEEHLNALDRAAG DGDCGTTRSRAARAIQEWLKEGPPPASPAQLLSKLSVLLLEKMGGSSGAL YGLFLTAAAQPLKAKTSLPAWSAAMDAGLEAMQKYGKAAPGDRTMLDSLW AAGQELQAWKSPGADLLQVLTKAVKSAEAAAEATKNMEAGAGRASYISSA RLEQPDPGAVAAAAILRAILEVLQS
    • Amino acids
      1 to 575
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161866 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ATP dependent dihydroxyacetone kinase
    • Bifunctional ATP dependent dihydroxyacetone kinase/FAD AMP lyase (cyclizing)
    • DAK
    • DHA kinase
    • Dha kinase/FMN cyclase
    • DHAK_HUMAN
    • Dihydroxyacetone kinase
    • Dihydroxyacetone kinase 2
    • Dihydroxyacetone kinase 2 homolog (S. cerevisiae)
    • Dihydroxyacetone kinase 2 homolog (yeast)
    • FAD AMP lyase (cyclic FMN forming)
    • FAD AMP lyase (cyclizing)
    • FAD-AMP lyase (cyclic FMN forming)
    • FAD-AMP lyase (cyclizing)
    • FMN cyclase
    • Glycerone kinase
    see all
  • Function
    Catalyzes both the phosphorylation of dihydroxyacetone and the splitting of ribonucleoside diphosphate-X compounds among which FAD is the best substrate.
  • Sequence similarities
    Belongs to the dihydroxyacetone kinase (DAK) family.
    Contains 1 DhaK domain.
    Contains 1 DhaL domain.
  • Information by UniProt

Images

  • ab161866 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161866 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161866.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up