Recombinant Human DAP Kinase 1 protein (ab152326)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      LLLDSVCSTIENVMATTLPGLLTVKHYLSPQQLREHHEPVMIYQPRDFFR AQTLKETSLTNTMGGYKESFSSIMCFGCHDVYSQASLGMDIHASDLNLLT
    • Molecular weight
      37 kDa including tags
    • Amino acids
      1210 to 1309

Specifications

Our Abpromise guarantee covers the use of ab152326 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DAK1
    • DAP K1
    • DAP kinase 1
    • DAPK
    • DAPK 1
    • DAPK1
    • DAPK1_HUMAN
    • Death Associated Protein Kinase 1
    • Death-associated protein kinase 1
    • DKFZp781I035
    see all
  • Function
    Calcium/calmodulin-dependent serine/threonine kinase which acts as a positive regulator of apoptosis.
  • Sequence similarities
    Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. DAP kinase subfamily.
    Contains 10 ANK repeats.
    Contains 1 death domain.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Ubiquitinated by the BCR(KLHL20) E3 ubiquitin ligase complex, leading to its degradation by the proteasome.
  • Cellular localization
    Cytoplasm. Colocalizes with the actin filament system.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152326 stained with Coomassie Blue.

References

ab152326 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152326.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up