Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP51397
    • SpeciesHuman
    • SequenceMSSPPEGKLETKAGHPPAVKAGGMRIVQKHPHTGDTKEEKDKDDQEWESP SPPKPTVFISGVIARGDKDFPPAAAQVAHQKPHASMDKHPSPRTQHIQQP RK
    • Molecular weight37 kDa including tags
    • Amino acids1 to 102

Specifications

Our Abpromise guarantee covers the use of ab114865 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Dap
    • DAP 1
    • DAP-1
    • DAP1_HUMAN
    • Death associated protein
    • Death associated protein 1
    • Death-associated protein 1
    • MGC99796
    • OTTHUMP00000161670
    • OTTHUMP00000221331
    see all
  • FunctionInvolved in mediating interferon-gamma-induced cell death.
  • Information by UniProt

Recombinant Human DAP1 protein images

  • ab114865 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.

References for Recombinant Human DAP1 protein (ab114865)

ab114865 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114865.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"