Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGRAELLEGKMSTQDPSDLWSRSDGEAELLQDLGWYHGNLTRHAAEALLL SNGCDGSYLLRDSNETTGLYSLSVRAKDSVKHFHVEYTGYSFKFGFNEFS SLKDFVKH
    • Amino acids
      1 to 108
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162071 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • B cell adapter molecule of 32 kDa
    • B lymphocyte adapter protein Bam32
    • B-cell adapter molecule of 32 kDa
    • BAM32
    • DAPP1
    • DAPP1_HUMAN
    • DKFZp667E0716
    • Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide
    • Dual adaptor of phosphotyrosine and 3 phosphoinositides
    • hDAPP1
    see all
  • Function
    May act as a B-cell-associated adapter that regulates B-cell antigen receptor (BCR)-signaling downstream of PI3K.
  • Tissue specificity
    Highly expressed in placenta and lung, followed by brain, heart, kidney, liver, pancreas and skeletal muscle. Expressed by B-lymphocytes, but not T-lymphocytes or nonhematopoietic cells.
  • Sequence similarities
    Contains 1 PH domain.
    Contains 1 SH2 domain.
  • Post-translational
    modifications
    Phosphorylated on tyrosine residues.
  • Cellular localization
    Cytoplasm. Membrane. Membrane-associated after cell stimulation leading to its translocation.
  • Information by UniProt

Images

  • ab162071 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162071 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162071.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up