Overview

  • Product nameRecombinant Human DARC protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ16570
    • SpeciesHuman
    • SequenceMGNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAP CHSCNLLDDSALPFFILTSVLGILASSTVLSMLFRPLFRWQLCPGWPVLA QLAVGSALFSIVVPVLAPGLGSTRSSALCSLGYCVWYGSAFAQALLLGCH ASLGHRLGAGQVPGLTLGLTVGIWGVAALLTLPVTLASGASGGLCTLIYS TELKALQATHTVACLAIFVLLPLGLFGAKGLKKALGMGPGPWMNILWAWF IFWWPHGVVLGLDFLVRSKLLLLSTCLAQQALDLLLNLAEALAILHCVAT PLLLALFCHQATRTLLPSLPLPEGWFSHLDTLGSKS
    • Molecular weight63 kDa including tags
    • Amino acids1 to 336

Specifications

Our Abpromise guarantee covers the use of ab114557 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CCBP1
    • CD234
    • DARC
    • Dfy
    • Duffy antigen/chemokine receptor
    • duffy blood group
    • Duffy blood group antigen
    • Duffy blood group chemokine receptor
    • DUFFY_HUMAN
    • FY
    • Fy glycoprotein
    • Glycoprotein D
    • GPD
    • GpFy
    • Plasmodium vivax receptor
    • WBCQ1
    see all
  • FunctionNon-specific receptor for many chemokines such as IL-8, GRO, RANTES, MCP-1 and TARC. It is also the receptor for the human malaria parasites Plasmodium vivax and Plasmodium knowlesi.
  • Tissue specificityFound in adult kidney, adult spleen, bone marrow and fetal liver. In particular, it is expressed along postcapillary venules throughout the body, except in the adult liver. Erythroid cells and postcapillary venule endothelium are the principle tissues expressing duffy. Fy(-A-B) individuals do not express duffy in the bone marrow, however they do, in postcapillary venule endothelium.
  • Sequence similaritiesBelongs to the G-protein coupled receptor Duffy family.
  • Cellular localizationMembrane.
  • Information by UniProt

Recombinant Human DARC protein images

  • 12.5% SDS-PAGE Stained with Coomassie Blue

References for Recombinant Human DARC protein (ab114557)

ab114557 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114557.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"