Recombinant Human DARPP32 protein (ab112426)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNPCAYTPPSLKAVQRIA ESHLQSISNLNENQASEEEDELGELRELGYPREEDEEEEEDDEEEEEEED SQAEVLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDGGSEDQVEDPA LSEPGEEPQRPSPSEPGT
    • Molecular weight
      44 kDa including tags
    • Amino acids
      1 to 168

Specifications

Our Abpromise guarantee covers the use of ab112426 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione

General Info

  • Alternative names
    • DARPP 32
    • DARPP-32
    • Dopamine and cAMP regulated neuronal phosphoprotein
    • Dopamine and cAMP regulated neuronal phosphoprotein 32
    • Dopamine and cAMP regulated phosphoprotein
    • Dopamine and cAMP regulated phosphoprotein DARPP 32
    • Dopamine and cAMP regulated phosphoprotein DARPP32
    • Dopamine- and cAMP-regulated neuronal phosphoprotein
    • FLJ20940
    • IPPD
    • Neuronal phosphoprotein DARPP 32
    • PPP1R1B
    • PPR1B_HUMAN
    • Protein phosphatase 1 regulatory (inhibitor) subunit 1B
    • Protein phosphatase 1 regulatory inhibitor subunit 1B
    • Protein phosphatase 1 regulatory subunit 1B
    see all
  • Function
    Inhibitor of protein-phosphatase 1.
  • Sequence similarities
    Belongs to the protein phosphatase inhibitor 1 family.
  • Post-translational
    modifications
    Dopamine- and cyclic AMP-regulated neuronal phosphoprotein.
    Phosphorylation of Thr-34 is required for activity.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab112426 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References

ab112426 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab112426.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up