Recombinant Human DARPP32 protein (ab112426)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNPCAYTPPSLKAVQRIA ESHLQSISNLNENQASEEEDELGELRELGYPREEDEEEEEDDEEEEEEED SQAEVLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDGGSEDQVEDPA LSEPGEEPQRPSPSEPGT
    • Molecular weight
      44 kDa including tags
    • Amino acids
      1 to 168

Specifications

Our Abpromise guarantee covers the use of ab112426 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione

General Info

  • Alternative names
    • DARPP 32
    • DARPP-32
    • Dopamine and cAMP regulated neuronal phosphoprotein
    • Dopamine and cAMP regulated neuronal phosphoprotein 32
    • Dopamine and cAMP regulated phosphoprotein
    • Dopamine and cAMP regulated phosphoprotein DARPP 32
    • Dopamine and cAMP regulated phosphoprotein DARPP32
    • Dopamine- and cAMP-regulated neuronal phosphoprotein
    • FLJ20940
    • IPPD
    • Neuronal phosphoprotein DARPP 32
    • PPP1R1B
    • PPR1B_HUMAN
    • Protein phosphatase 1 regulatory (inhibitor) subunit 1B
    • Protein phosphatase 1 regulatory inhibitor subunit 1B
    • Protein phosphatase 1 regulatory subunit 1B
    see all
  • Function
    Inhibitor of protein-phosphatase 1.
  • Sequence similarities
    Belongs to the protein phosphatase inhibitor 1 family.
  • Post-translational
    modifications
    Dopamine- and cyclic AMP-regulated neuronal phosphoprotein.
    Phosphorylation of Thr-34 is required for activity.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Recombinant Human DARPP32 protein images

  • ab112426 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human DARPP32 protein (ab112426)

ab112426 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112426.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up