Overview

  • Product name
    Recombinant Human DARS protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMPSASASRKSQEKPREIMDAAEDYAKERYG ISSMIQSQEKPDRVLVRVRDLTIQKADEVVWVRARVHTSRAKGKQCFLVL RQQQFNVQALVAVGDHASKQMVKFAANINKESIVDVEGVVRKVNQKIGSC TQQDVELHVQKIYVISLAEPRLPLQLDDAVRPEAEGEEEGRATVNQDTRL DNRVIDLRTSTSQAVFRLQSGICHLFRETLINKGFVEIQTPKIISAASEG GANVFTVSYFKNNAYLAQSPQLYKQMCICADFEKVFSIGPVFRAEDSNTH RHLTEFVGLDIEMAFNYHYHEVMEEIADTMVQIFKGLQERFQTEIQTVNK QFPCEPFKFLEPTLRLEYCEALAMLREAGVEMGDEDDLSTPNEKLLGHLV KEKYDTDFYILDKYPLAVRPFYTMPDPRNPKQSNSYDMFMRGEEILSGAQ RIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLERVTMLF LGLHNVRQTSMFPRDPKRLTP
    • Molecular weight
      59 kDa including tags
    • Amino acids
      1 to 501
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab124568 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 85 % SDS-PAGE.
    ab124568 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 40% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names
    • Aspartate tRNA ligase
    • Aspartate tRNA ligase 1 cytoplasmic
    • Aspartate--tRNA ligase
    • Aspartyl tRNA synthetase
    • Aspartyl tRNA synthetase cytoplasmic
    • Aspartyl-tRNA synthetase
    • AspRS
    • Cell proliferation inducing gene 40 protein
    • Cell proliferation inducing protein 40
    • Cell proliferation-inducing gene 40 protein
    • cytoplasmic
    • Dars
    • DKFZp781B11202
    • MGC111579
    • SYDC_HUMAN
    see all
  • Function
    Catalyzes the specific attachment of an amino acid to its cognate tRNA in a 2 step reaction: the amino acid (AA) is first activated by ATP to form AA-AMP and then transferred to the acceptor end of the tRNA.
  • Sequence similarities
    Belongs to the class-II aminoacyl-tRNA synthetase family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Recombinant Human DARS protein images

  • 15% SDS-PAGE analysis of 3 µg ab124568.

References for Recombinant Human DARS protein (ab124568)

ab124568 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab124568.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up