Overview

  • Product name
    Recombinant Human DAZ3 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      YPNSAVQVTTGYQFHVYNYQMPPQCPVGEQRRNLWTEAYKWWYLVCLIQR RD
    • Amino acids
      387 to 438
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163469 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DAZ3
    • DAZ3_HUMAN
    • deleted in azoospermia 3
    • Deleted in azoospermia protein 3
    • MGC126441
    • pDP1679
    see all
  • Function
    RNA-binding protein that plays an essential role in spermatogenesis. May act by binding to the 3'-UTR of mRNAs and regulating their translation.
  • Tissue specificity
    Testis specific.
  • Involvement in disease
    Spermatogenic failure Y-linked 2
  • Sequence similarities
    Belongs to the RRM DAZ family.
    Contains 12 DAZ-like domains.
    Contains 1 RRM (RNA recognition motif) domain.
  • Domain
    The DAZ-like repeats are essential and mediate the interaction with DAZAP1 and DAZAP2.
  • Cellular localization
    Cytoplasm. Nucleus. Predominantly cytoplasmic. Nuclear at some stages of spermatozoide development. Localizes both to the nuclei and cytoplasm of spermatozoide differentiation. Nuclear in fetal gonocytes and in spermatogonial nuclei. It then relocates to the cytoplasm during male meiosis.
  • Information by UniProt

Images

  • ab163469 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163469 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163469.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up