Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      TISAHKPLLISSCDWMAAMFGGPFVESSTREVVFPYTSKSCMRAVLEYLY TGMFTSSPDLDDMKLIILANRLCLPHLVALTEQYTVTGLMEATQMMVDID GDVLVFLELA
    • Amino acids
      510 to 619
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161577 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DBC 2
    • Deleted in breast cancer 2
    • Deleted in breast cancer 2 gene protein
    • p83
    • RHBT2_HUMAN
    • Rho related BTB domain containing 2
    • Rho related BTB domain containing protein 2
    • Rho-related BTB domain-containing protein 2
    • RHOBTB 2
    • Rhobtb2
    see all
  • Tissue specificity
    Ubiquitous, with highest levels in neural tissues. Expression is also detected in fetal lung, heart, and brain.
  • Sequence similarities
    Belongs to the small GTPase superfamily. Rho family.
    Contains 2 BTB (POZ) domains.
  • Information by UniProt

Images

  • ab161577 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161577 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161577.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up