Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MNSGAMRIHSKGHFQGGIQVKNEKNRPSLKSLKTDNRPEKSKCKPLWGKV FYLDLPSVTISEKLQKDIKDLGGRVEEFLSKDISYLISNKKEAKFAQTLG RISPVPSPESAYTAETTSPHPSHDGSSFKSPDTVCLSRGKLLVEKAIKDH DFIPSNSILSNALSWGVKILHIDDIRYYIEQKKKELYLLKKSSTSVRDGG KRVGSGAQKTRTGRLKKPFVKVEDMSQLYRPFYLQLTNMPFINYSIQKPC SPFDVDKPSSMQKQTQVKLRIQTDGDKYGGTSIQLQLKEKKKKGYCECCL QKYEDLETHLLSEQHRNFAQSNQYQVVDDIVSKLVFDFVEYEKDTPKKKR IKYSVGSLSPVSASVLKKTEQKEKVELQHISQKDCQEDDTTVKEQNFLYK ETQETEKKLLFISEPIPHPSNELRGLNEKMSNKCSMLSTAEDDIRQNFTQ LPLHKNKQECILDISEHTLSENDLEELRVDHYKCNIQASVHVSDFSTDNS GSQPKQKSDTVLFPAKDLKEKDLHSIFTHDSGLITINSSQEHLTVQAKAP FHTPPEEPNECDFKNMDSLPSGKIHRKVKIILGRNRKENLEPNAEFDKRT EFITQEENRICSSPVQSLLDLFQTSEEKSEFLGFTSYTEKSGICNVLDIW EEENSDNLLTAFFSSPSTSTFTGF
    • Amino acids
      1 to 674
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161205 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Activator of S phase kinase
    • ASK
    • CHIF
    • Chiffon homolog A
    • DBF4
    • DBF4 homolog
    • DBF4 homolog (S. cerevisiae)
    • DBF4 type zinc finger containing protein 1
    • DBF4 zinc finger
    • DBF4 zinc finger A
    • DBF4, S. cerevisiae, homolog of
    • DBF4-type zinc finger-containing protein 1
    • DBF4A
    • DBF4A_HUMAN
    • Dumbbell former 4, S. cerevisiae, homolog of
    • OTTHUMP00000161661
    • Protein DBF4 homolog A
    • ZDBF1
    • Zinc finger, DBF-type containing 1
    see all
  • Function
    Regulatory subunit for CDC7 which activates its kinase activity thereby playing a central role in DNA replication and cell proliferation. Required for progression of S phase. The complex CDC7-DBF4A selectively phosphorylates MCM2 subunit at 'Ser-40' and 'Ser-53' and then is involved in regulating the initiation of DNA replication during cell cycle.
  • Tissue specificity
    Highly expressed in testis and thymus. Expressed also in most cancer cells lines.
  • Sequence similarities
    Contains 2 BRCT domains.
    Contains 1 DBF4-type zinc finger.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab161205 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161205 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161205.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up