Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      VKKQQPKKPEGTCPAAESRTRKVARLKAPFLKIEDESRKFRPFHHQFKSF PEISFLGPKDASPFEAPTTLGSMHHTRESKDGEPSPRSAAHTMPRRKKG
    • Amino acids
      201 to 299
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164213 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Activator of S phase kinase like protein 1
    • Activator of S phase kinase-like protein 1
    • ASK like protein 1
    • ASK-like protein 1
    • ASKL1
    • chifb
    • Chiffon homolog B
    • DBF 4B
    • DBF4 homolog B
    • DBF4 homolog B (S. cerevisiae)
    • Dbf4 related factor 1
    • Dbf4-related factor 1
    • dbf4b
    • DBF4B_HUMAN
    • DRF1
    • FLJ13087
    • MGC15009
    • Protein DBF4 homolog B
    • ZDBF1B
    • Zinc finger DBF type containing 1B
    see all
  • Function
    Regulatory subunit for CDC7 which activates its kinase activity thereby playing a central role in DNA replication and cell proliferation. Required for progression of S and M phases. The complex CDC7-DBF4B selectively phosphorylates MCM2 subunit at 'Ser-40' and then is involved in regulating the initiation of DNA replication during cell cycle.
  • Tissue specificity
    Widely expressed. Highly expressed in testis.
  • Sequence similarities
    Contains 1 BRCT domain.
    Contains 1 DBF4-type zinc finger.
  • Developmental stage
    Increases as cells enter in S phase through G2/M phase. The protein has a short half-life (at protein level).
  • Post-translational
    modifications
    Phosphorylated.
  • Cellular localization
    Nucleus. Predominantly found in soluble fraction but not in the chromatin-bound fraction.
  • Information by UniProt

Images

  • ab164213 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164213 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164213.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up