Overview

  • Product name
    Recombinant Human DBPA protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      HVGQTFDRRSRVLPHPNRIQAGEIGEMKDGVPEGAQLQGPVHRNPTYRPR YRSRGPPRPRPAPAVGEAEDKENQQATSGPNQPSVRRGYR
    • Amino acids
      241 to 330
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160078 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cold shock domain containing protein A
    • Cold shock domain protein A
    • Cold shock domain-containing protein A
    • csdA
    • CSDA1
    • DBPA
    • DBPA_HUMAN
    • DNA binding protein A
    • DNA-binding protein A
    • Single strand DNA binding protein NF GMB
    • Single-strand DNA-binding protein NF-GMB
    • ZO 1 associated nucleic acid binding protein
    • ZO1 associated nucleic acid binding protein
    • ZONAB
    see all
  • Function
    Binds to the GM-CSF promoter. Seems to act as a repressor. Binds also to full length mRNA and to short RNA sequences containing the consensus site 5'-UCCAUCA-3'. May have a role in translation repression.
  • Tissue specificity
    Highly expressed in skeletal muscle and heart.
  • Sequence similarities
    Contains 1 CSD (cold-shock) domain.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • ab160078 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160078 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160078.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up