Overview

  • Product name
    Recombinant Human DCAF5 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MKRRAGLGGSMRSVVGFLSQRGLHGDPLLTQDFQRRRLRGCRNLYKKDLL GHFGCVNAIEFSNNGGQWLVSGGDDRRVLLWHMEQAIHSRVKPIQLKGEH HSNIFCLAFNSGNTKVFSGGNDEQVILHDVESSETLDVFAHEDAVYGLSV SPVNDNIFASSSDDGRVLIWDIRESPHGEPFCLANYPSAFHSVMFNPVEP RLLATANSKEGVGLWDIRKPQSSLLRYGGNLSLQSAMSVRFNSNGTQLLA LRRRLPPVLYDIHSRLPVFQFDNQGYFNSCTMKSCCFAGDRDQHHNWKWR AQAVSFQPFLSLTRNGDADVDLKLAV
    • Amino acids
      1 to 326
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160207 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BCRG2
    • BCRP2
    • Breakpoint cluster region protein 2
    • Breakpoint cluster region protein, uterine leiomyoma, 2
    • D14S1461E
    • Dcaf5
    • DCAF5_HUMAN
    • DDB1 and CUL4 associated factor 5
    • DDB1- and CUL4-associated factor 5
    • WD repeat-containing protein 22
    • WDR22
    see all
  • Function
    May function as a substrate receptor for CUL4-DDB1 E3 ubiquitin-protein ligase complex.
  • Tissue specificity
    Ubiquitous.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Contains 6 WD repeats.
  • Information by UniProt

Images

  • ab160207 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160207 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160207.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up