Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      STPMLPPVGVQAVALTHDAVRVSWADNSVPKNQKTSEVRLYTVRWRTSFS ASAKYKSEDTTSLSYTATGLKPNTMYEFSVMVTKNRRSSTWSMTAHATTY E
    • Molecular weight
      11 kDa
    • Amino acids
      841 to 941
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab157070 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Binds to Human and mouse netrin-1.
  • Applications

    SDS-PAGE

  • Endotoxin level
    < 0.100 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Lyophilised
  • Additional notes
    Binds to Human and mouse netrin-1.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C.

    Constituent: 99% PBS

  • Reconstitution
    Reconstitute with 50µl sterile water. Further dilutions should be made with medium containing 5% fetal calf serum. After reconstitution, prepare aliquots and store at -20°C. Avoid freeze/thaw cycles.

General Info

  • Alternative names
    • Colorectal cancer related chromosome sequence 18
    • Colorectal cancer suppressor
    • CRC 18
    • CRC18
    • CRCR 1
    • CRCR1
    • DCC
    • DCC_HUMAN
    • Deleted in colorectal cancer protein
    • Deleted in colorectal carcinoma
    • Immunoglobulin superfamily DCC subclass member 1
    • Netrin receptor DCC
    • Tumor suppressor protein DCC
    see all
  • Function
    Receptor for netrin required for axon guidance. Mediates axon attraction of neuronal growth cones in the developing nervous system upon ligand binding. Its association with UNC5 proteins may trigger signaling for axon repulsion. It also acts as a dependence receptor required for apoptosis induction when not associated with netrin ligand. Implicated as a tumor suppressor gene.
  • Tissue specificity
    Found in axons of the central and peripheral nervous system and in differentiated cell types of the intestine. Not expressed in colorectal tumor cells that lost their capacity to differentiate into mucus producing cells.
  • Involvement in disease
    Defects in DCC are the cause of congenital mirror movements (MIMOC) [MIM:157600]. Mirror movements are contralateral involuntary movements that mirror voluntary ones. While mirror movements are occasionally found in young children, persistence beyond the age of 10 is abnormal. Mirror movements occur more commonly in the upper extremities.
  • Sequence similarities
    Belongs to the immunoglobulin superfamily. DCC family.
    Contains 6 fibronectin type-III domains.
    Contains 4 Ig-like C2-type (immunoglobulin-like) domains.
  • Post-translational
    modifications
    Ubiquitinated; mediated by SIAH1 or SIAH2 and leading to its subsequent proteasomal degradation.
  • Cellular localization
    Membrane.
  • Information by UniProt

References

ab157070 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157070.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up