Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MKFKNPPVNSLSLEFLTELVISLEKLENDKSFRGVILTSDRPGVFSAGLD LTEMCGRSPAHYAGYWKAVQELWLRLYQSNLVLVSAINGACPAGGCLVAL TCDYRILADNPRYCIGLNETQLGIIAPFWLKDTLENTIGHRAAERALQLG LLFPPAEALQVGIVDQVVPEEQVQSTALSAIAQWMAIPDHARQLTKAMMR KATASRLVTQRDADVQNFVSFISKDSIQKSLQMYLERLKEEKG
    • Amino acids
      1 to 243
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158264 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2-trans-enoyl-CoA isomerase
    • 3
    • 3,2 trans enoyl Coenzyme A isomerase
    • 3,2 trans-enoyl-CoA isomerase
    • 3,2-trans-enoyl-CoA isomerase, mitochondrial
    • Acetylene allene isomerase
    • D2-enoyl-CoA isomerase
    • D3
    • D3,D2 enoyl CoA isomerase
    • DCI
    • DCI protein
    • delta(2)-enoyl-CoA isomerase
    • Delta(3)
    • Delta(3),Delta(2) enoyl CoA isomerase
    • Delta3, delta2 enoyl CoA isomerase
    • Dodecenoyl CoA delta Isomerase
    • Dodecenoyl CoA isomerase
    • Dodecenoyl Coenzyme A delta isomerase
    • Dodecenoyl Coenzyme A delta isomerase (3,2 trans enoyl Coenzyme A isomerase)
    • Dodecenoyl Coenzyme A delta isomerase 3,2 trans enoyl Coenzyme A isomerase, isoform CRA a
    • Dodecenoyl-CoA isomerase
    • ECI1
    • ECI1_HUMAN
    • Enoyl-CoA delta isomerase 1
    • enoyl-CoA delta isomerase 1, mitochondrial
    • mitochondrial
    see all
  • Function
    Able to isomerize both 3-cis and 3-trans double bonds into the 2-trans form in a range of enoyl-CoA species.
  • Pathway
    Lipid metabolism; fatty acid beta-oxidation.
  • Sequence similarities
    Belongs to the enoyl-CoA hydratase/isomerase family.
  • Cellular localization
    Mitochondrion matrix.
  • Information by UniProt

Images

  • ab158264 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158264 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158264.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up