Overview

  • Product name
    Recombinant Human DCLK3 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      EKLVRTRSCRRSPEANPASGEEGWKGDSHRSSPRNPTQELRRPSKSMDKK EDRGPEDQESHAQGAAKAKKDLVEVLPVTEEGLREVKKDTRPMSRSKHGG WLLREHQAGF
    • Amino acids
      1031 to 1140
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164758 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BC056929
    • C730036H08
    • CLICK I and II related; CLr
    • Click I II related
    • CLR
    • Dcamkl3
    • DCDC3C
    • DCK3
    • Dclk3
    • DCLK3_HUMAN
    • Doublecortin and CaM kinase like 3
    • Doublecortin domain-containing protein 3C
    • Doublecortin-like and CAM kinase-like 3
    • Doublecortin-like kinase 3
    • hCG_16695
    • KIAA1765
    • RGD1309232
    • Serine/threonine-protein kinase DCLK3
    see all
  • Sequence similarities
    Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. CaMK subfamily.
    Contains 1 protein kinase domain.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • ab164758 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164758 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164758.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up