Overview

  • Product name
    Recombinant Human DCPS protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMADAAPQLGKRKRELDVEEAHAASTEE KEAGVGNGTCAPVRLPFSGFR LQKVLRESARDKIIFLHGKVNEASGDG DGEDAVVILEKTPFQVEQVAQLLTGSPELQLQFSNDIYSTYHLFPPRQ LNDVKTTVVYPATEKHLQKYLRQDLRLIRETGDDYRNITLPHLESQSLSI QWVYNILDKKAEADRIVFENPDPSD GFVLIPDLKWNQQQLDDLYLIAI CHRRGIRSLRDLTPEHLPLLRNILHQGQEAILQRYRMKGDHLRVYLHYLP SY YHLHVHFTALGFEAPGSGVERAHLLAEVIENLECDPRHYQQRTLTF ALRADDPLLKLLQEAQQS
    • Molecular weight
      41 kDa including tags
    • Amino acids
      1 to 337
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113138 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab113138 was purified using conventional chromatography.
  • Form
    Liquid
  • Additional notes


  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
    Mix suspension via gentle inversion before use.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 20% Glycerol, 0.02% DTT

General Info

  • Alternative names
    • 1700001E16Rik
    • AA408441
    • ARS
    • DCPS
    • DCPS_HUMAN
    • DCS 1
    • DCS-1
    • DCS1
    • Decapping enzyme scavenger
    • heat shock-like protein 1
    • Hint 5
    • Hint related 7meGMP directed hydrolase
    • HINT-5
    • Hint-related 7meGMP-directed hydrolase
    • HINT5
    • Histidine triad protein member 5
    • homolog of C. elegans 7meGMP-directed hydrolase dcs-1
    • HSL1
    • HSPC015
    • m7GpppX diphosphatase
    • MGC124934
    • mRNA decapping enzyme
    • OTTMUSP00000042220
    • Scavenger mRNA decapping enzyme DcpS
    • Scavenger mRNA-decapping enzyme DcpS
    see all
  • Function
    Necessary for the complete degradation of mRNAs, both in normal mRNA turnover and in nonsense-mediated mRNA decay. Removes the 7-methyl guanine cap structure from mRNA fragments shorter than 10 nucleotides that are produced by 3'->5' exosome-mediated mRNA decay. Releases m7GMP. Can also degrade m7GDP to m7GMP. Has no activity towards mRNA molecules longer than 25 nucleotides.
  • Tissue specificity
    Detected in liver, brain, kidney, testis and prostate.
  • Sequence similarities
    Belongs to the HIT family.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt

Recombinant Human DCPS protein images

  • 15% SDS-PAGE analysis of (3µg)

References for Recombinant Human DCPS protein (ab113138)

ab113138 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113138.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up