Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      ATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRSEHTGACNPCTEGVDY TNASNNEPSC FPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNENSPEMCRKCSRCPSGE VQVSNCTSWD DIQCVEEFGANATVETPAAEETMNTSPGTPAPAAEETMNTSPGTPAPAAE ETMTTSPGTP APAAEETMTTSPGTPAVDHHHHHH
    • Molecular weight
      22 kDa including tags
    • Amino acids
      26 to 221
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151632 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    ab151632 is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.

    Constituents: 99.2% Phosphate Buffer, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

General Info

  • Alternative names
    • Antagonist decoy receptor for TRAIL/Apo 2L
    • CD263
    • Cytotoxic TRAIL receptor 3
    • DCR1
    • DCR1 TNFR
    • Decoy Receptor 1
    • Decoy TRAIL receptor without death domain
    • LIT
    • Lymphocyte inhibitor of TRAIL
    • MGC149501
    • MGC149502
    • TNF related apoptosis inducing ligand receptor 3
    • TNF-re ated apoptosis inducing ligand receptor 3
    • TNFRSF10C
    • TRAIL R3
    • TRAIL receptor 3
    • TRAILR3
    • TRID
    • Tumor necrosis factor receptor superfamily member 10C
    • Tumor necrosis factor receptor superfamily, member 10c, decoy without an intracellular domain
    see all
  • Relevance
    DcR1 / TRAIL-R3 / TRID / LIT is one of the two putative decoy receptors identified for TRAIL, one of the members of TNF family of apoptosis inducing proteins. The other putative decoy receptor is called DcR2 / TRUNDD / TRAIL-R4. DcR1 is attached to the cell surface through glycophospholipid anchor. It has the extracellular TRAIL binding domain but lacks the cytoplasmic domain to induce apoptotic signal. Hence overexpression of DcR1 inhibits the TRAIL induced apoptosis.
  • Cellular localization
    Cell Membrane and Cytoplasmic

References

ab151632 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151632.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up