Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      SATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRSEHTGACNPCTEGVD YTNASNNEPSCFPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNENSPEM CRKCSRCPSGEVQVSNCTSWDDIQCVEEFGANATVETPAAEETMNTSPGT PAPAAEETMNTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPAPAA EETMITSPGTPASSHY
    • Molecular weight
      66 kDa
    • Amino acids
      25 to 240

Associated products

Specifications

Our Abpromise guarantee covers the use of ab157352 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Binds Human and mouse TRAIL.

    Inhibits Human soluble TRAIL-mediated apoptosis in a concentration range of 50-100ng/ml.

  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level
    < 0.100 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20ºC.

    Constituent: 99% PBS

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute with 50µl sterile water to a final concentration of 1 mg/ml. Further dilutions should be made with medium containing 5% fetal calf serum or a carrier protein. After reconstitution, prepare aliquots and store at -20°C. Avoid freeze/thaw cycles.

General Info

  • Alternative names
    • Antagonist decoy receptor for TRAIL/Apo 2L
    • CD263
    • Cytotoxic TRAIL receptor 3
    • DCR1
    • DCR1 TNFR
    • Decoy Receptor 1
    • Decoy TRAIL receptor without death domain
    • LIT
    • Lymphocyte inhibitor of TRAIL
    • MGC149501
    • MGC149502
    • TNF related apoptosis inducing ligand receptor 3
    • TNF-re ated apoptosis inducing ligand receptor 3
    • TNFRSF10C
    • TRAIL R3
    • TRAIL receptor 3
    • TRAILR3
    • TRID
    • Tumor necrosis factor receptor superfamily member 10C
    • Tumor necrosis factor receptor superfamily, member 10c, decoy without an intracellular domain
    see all
  • Relevance
    DcR1 / TRAIL-R3 / TRID / LIT is one of the two putative decoy receptors identified for TRAIL, one of the members of TNF family of apoptosis inducing proteins. The other putative decoy receptor is called DcR2 / TRUNDD / TRAIL-R4. DcR1 is attached to the cell surface through glycophospholipid anchor. It has the extracellular TRAIL binding domain but lacks the cytoplasmic domain to induce apoptotic signal. Hence overexpression of DcR1 inhibits the TRAIL induced apoptosis.
  • Cellular localization
    Cell Membrane and Cytoplasmic

Images

  • Inhibition of TRAIL-mediated lysis. ab157352 exerts its inhibitory activity in a concentration range of 50-100µg/ml.

    Method: Human Jurkat lymphoma cells (50,000 cells in 100µl DMEM medium containing 5% fetal calf serum) were incubated with 0.1µg/ml soluble TRAIL plus 2µg/ml enhancer and increasing concentrations of ab157352 in a 96-well plate for 16 hours at 37°C. Concentrations of ab157352 required to inhibit may vary depending on the cell type studied and on the concentration of sTRAIL used to kill cells. Cell viability was determined using a MTT-based cell proliferation assay kit.

References

ab157352 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157352.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up