Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MARIPKTLKFVVVIVAVLLPVLAYSATTARQEEVPQQTVAPQQQRHSFKG EECPAGSHRSEHTGACNPCTEGVDYTNASNNEPSCFPCTVCKSDQKHKSS CTMTRDTVCQCKEGTFRNENSPEMCRKCSRCPSGEVQVSNCTSWDDIQCV EEFGANATVETPAAEETMNTSPGTPAPAAEETMNTSPGTPAPAAEETMTT SPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPASSHYLSCTIVGIIV LIVLLIVFV
    • Amino acids
      1 to 259
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160192 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Antagonist decoy receptor for TRAIL/Apo 2L
    • CD263
    • Cytotoxic TRAIL receptor 3
    • DCR1
    • DCR1 TNFR
    • Decoy Receptor 1
    • Decoy TRAIL receptor without death domain
    • LIT
    • Lymphocyte inhibitor of TRAIL
    • MGC149501
    • MGC149502
    • TNF related apoptosis inducing ligand receptor 3
    • TNF-re ated apoptosis inducing ligand receptor 3
    • TNFRSF10C
    • TRAIL R3
    • TRAIL receptor 3
    • TRAILR3
    • TRID
    • Tumor necrosis factor receptor superfamily member 10C
    • Tumor necrosis factor receptor superfamily, member 10c, decoy without an intracellular domain
    see all
  • Relevance
    DcR1 / TRAIL-R3 / TRID / LIT is one of the two putative decoy receptors identified for TRAIL, one of the members of TNF family of apoptosis inducing proteins. The other putative decoy receptor is called DcR2 / TRUNDD / TRAIL-R4. DcR1 is attached to the cell surface through glycophospholipid anchor. It has the extracellular TRAIL binding domain but lacks the cytoplasmic domain to induce apoptotic signal. Hence overexpression of DcR1 inhibits the TRAIL induced apoptosis.
  • Cellular localization
    Cell Membrane and Cytoplasmic

Images

  • ab160192 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160192 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160192.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up