Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      ATIPRQDEVPQQTVAPQQQRRSLKEEECPAGSHRSEYTGACNPCTEGVDY TIASNNLPSCLLCTVCKSGQTNKSSCTTTRDTVCQCEKGSFQDKNSPEMC RTCRTGCPRGMVKVSNCTPRSDIKCKNESAASSTGKTPAAEETVTTILGM LASPYHY
    • Molecular weight
      54 kDa
    • Amino acids
      56 to 212

Specifications

Our Abpromise guarantee covers the use of ab157262 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Inhibits Human TRAIL-mediated apoptosis in a concentration range of 2-10µg/ml.
  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level
    < 0.100 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Lyophilised
  • Additional notes
    Inhibits Human TRAIL-mediated apoptosis in a concentration range of 2-10µg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20ºC.

    Constituent: 99% PBS

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute with 50µl sterile water. Further dilutions should be made with medium containing 5% fetal calf serum or a carrier protein. After reconstitution, prepare aliquots and store at -20°C. Avoid freeze/thaw cycles.

General Info

  • Alternative names
    • CD 264
    • CD264
    • DcR 2
    • DcR2
    • Decoy receptor 2
    • Decoy with truncated death domain
    • OTTHUMP00000123528
    • TNF receptor related receptor for TRAIL
    • TNF related apoptosis inducing ligand receptor 4
    • TNF-related apoptosis-inducing ligand receptor 4
    • TNFRSF 10D
    • TNFRSF10D
    • TR10D_HUMAN
    • TRAIL R4
    • TRAIL receptor 4
    • TRAIL receptor with a truncated death domain
    • TRAIL-R4
    • TRAILR4
    • TRUNDD
    • Tumor necrosis factor receptor superfamily member 10D
    • Tumor necrosis factor receptor superfamily, member 10d, decoy with truncated death domain
    see all
  • Function
    Receptor for the cytotoxic ligand TRAIL. Contains a truncated death domain and hence is not capable of inducing apoptosis but protects against TRAIL-mediated apoptosis. Reports are contradictory with regards to its ability to induce the NF-kappa-B pathway. According to PubMed:9382840, it cannot but according to PubMed:9430226, it can induce the NF-kappa-B pathway.
  • Tissue specificity
    Widely expressed, in particular in fetal kidney, lung and liver, and in adult testis and liver. Also expressed in peripheral blood leukocytes, colon and small intestine, ovary, prostate, thymus, spleen, pancreas, kidney, lung, placenta and heart.
  • Sequence similarities
    Contains 1 death domain.
    Contains 3 TNFR-Cys repeats.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • Inhibition of soluble Human TRAIL-mediated lysis. ab157262 exerts its inhibitory activity in a concentration range of 2-10µg/ml.

References

ab157262 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157262.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up