Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMSEVSCKKRDDYLEWPEYFMAVAFLSAQRS KDPNSQVGACIVNSENKIVGIGYNGMPNGCSDDVLPWRRTAENKLDTKYP YVCHAELNAIMNKNSTDVKGCSMYVALFPCNECAKLIIQAGIKEVIFMSD KYHDSDEATAARLLFNMAGVTFRKFIPKCSKIVIDFDSINSRPSQKLQ
    • Molecular weight
      22 kDa including tags
    • Amino acids
      1 to 178
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab96766 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Purity
    > 90 % SDS-PAGE.
    ab96766 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • dCMP deaminase
    • dctD
    • DCTD_HUMAN
    • Deoxycytidylate deaminase
    • MGC111062
    see all
  • Function
    Supplies the nucleotide substrate for thymidylate synthetase.
  • Sequence similarities
    Belongs to the cytidine and deoxycytidylate deaminase family.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab96766 at approximately 22.1kDa (3µg).

References

ab96766 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab96766.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up