Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP32321
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMSEVSCKKRDDYLEWPEYFMAVAFLSAQRS KDPNSQVGACIVNSENKIVGIGYNGMPNGCSDDVLPWRRTAENKLDTKYP YVCHAELNAIMNKNSTDVKGCSMYVALFPCNECAKLIIQAGIKEVIFMSD KYHDSDEATAARLLFNMAGVTFRKFIPKCSKIVIDFDSINSRPSQKLQ
    • Molecular weight22 kDa including tags
    • Amino acids1 to 178
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab96766 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Purity> 90 % SDS-PAGE.
    ab96766 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • dCMP deaminase
    • dctD
    • DCTD_HUMAN
    • Deoxycytidylate deaminase
    • MGC111062
    see all
  • FunctionSupplies the nucleotide substrate for thymidylate synthetase.
  • Sequence similaritiesBelongs to the cytidine and deoxycytidylate deaminase family.
  • Information by UniProt

Recombinant Human DCTD protein images

  • 15% SDS-PAGE showing ab96766 at approximately 22.1kDa (3µg).

References for Recombinant Human DCTD protein (ab96766)

ab96766 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab96766.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"