Overview

  • Product name
    Recombinant Human DCTN5 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MASMTGGQQMGRGEFMELGELLYNKSEYIETASGNKVSRQSVLCGSQNIV LNGKTIVMNDCIIRGDLANVRVGRHCVVKSRSVIRPPFKKFSKGVAFFPL HIGDHVFIEEDCVVNAAQIGSYVHVGKNCVIGRRCVLKDCCKILDNTVLP PETVVPPFTVFSGCPGLFSGELPECTQELMIDVTKSYYQKFLPLTQV
    • Molecular weight
      22 kDa including tags
    • Amino acids
      1 to 182
    • Tags
      T7 tag N-Terminus
    • Additional sequence information
      NP_115875.

Specifications

Our Abpromise guarantee covers the use of ab182817 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.
    The final product was refolded using unique “temperature shift inclusion body refolding” technology and chromatographically purified.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

General Info

  • Alternative names
    • DCTN 5
    • DCTN5
    • DCTN5_HUMAN
    • Dynactin 4
    • Dynactin 5 (p25)
    • Dynactin subunit 5
    • Dynactin subunit p25
    • p25
    see all
  • Sequence similarities
    Belongs to the dynactin subunits 5/6 family. Dynactin subunit 5 subfamily.
  • Cellular localization
    Cytoplasm > cytoskeleton.
  • Information by UniProt

References

ab182817 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab182817.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up