Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAEKTQKSVKIAPGAVVCVESEIRGDVTIGPRTVIHPKARIIAEAGPIVI GEGNLIEEQALIINAYPDNITPDTEDPEPKPMIIGTNNVFEVGCYSQAMK MGDNNVIESKAYVGRNVILTSGCIIGACCNLNTFEVIPENTVIYGADCLR RVQTERPQPQTLQLDFLMKILPNYHHLKKTMKGSSTPVKN
    • Amino acids
      1 to 190
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161104 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DCTN6
    • DCTN6_HUMAN
    • Dynactin 6
    • Dynactin subunit 6
    • Dynactin subunit p27
    • Novel RGD containing protein
    • p27
    • Protein WS-3
    • Protein WS3
    • WS 3
    • WS3
    see all
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Belongs to the dynactin subunits 5/6 family. Dynactin subunit 6 subfamily.
  • Cellular localization
    Cytoplasm > cytoskeleton.
  • Information by UniProt

Images

  • ab161104 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161104 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161104.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up