Recombinant Human DCUN1D1 protein (ab103056)

Overview

  • Product name
    Recombinant Human DCUN1D1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMNKLKSSQKDKVRQFMIFTQSSEKTAVSCL SQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNRYKDPQDENK IGIDGIQQFCDDLALDPASISVLIIAWKFRAATQCEFSKQEFMDGMTELG CDSIEKLKAQIPKMEQELKEPGRFKDFYQFTFNFAKNPGQKGLDLEMAIA YWNLVLNGRFKFLDLWNKFLLEHHKRSIPKDTWNLLLDFSTMIADDMSNY DEEGAWPVLIDDFVEFARPQIAGTKSTTV
    • Molecular weight
      32 kDa including tags
    • Amino acids
      1 to 259
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab103056 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab103056 was purified using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, pH 8.0

General Info

  • Alternative names
    • DCN1 defective in cullin neddylation 1 domain containing 1
    • DCN1 like protein 1
    • DCNL1
    • DCUN1 domain containing protein 1
    • DCUN1L1
    • Defective in cullin neddylation protein 1 like protein 1
    • RP 42
    • RP42
    • RP42 homolog
    • SCCRO
    • SCRO
    • Squamous cell carcinoma related oncogene
    • Tes 3
    • Tes3
    see all
  • Relevance
    DCUN1D1 (DCUN1 domain-containing protein 1) contains a DUF298 domain and a UBA-like ubiquitin. Forms part of an E3 ubiquitin ligase complex for neddylation. Required for neddylation of cullin components of E3 cullin-RING ubiquitin ligase complexes by enhancing the rate of cullins neddylation. Functions to recruit the NEDD8-charged E2 enzyme to the cullin component. Involved in the release of inhibitory effets of CAND1 on cullin-RING ligase E3 complex assembly and activity. Acts also as an oncogene facilitating malignant transformation and carcinogenic progression. Defects in DCUN1D1 may be a cause of squamous cell carcinomas. Strongly overexpressed in thyroid tumors, bronchioloalveolar carcinomas, and malignant tissues of squamous cell carcinoma of the oral tongue. Not overexpressed in aggressive adrenocortical carcinomas.

Images

  • 15% SDS-PAGE (3 µg)

References

ab103056 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab103056.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up