Recombinant Human DCUN1D2 protein (ab113157)

Overview

  • Product nameRecombinant Human DCUN1D2 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ6PH85
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMHKLKSSQKDKVRQFMACTQAGERTAIYCL TQNEWRLDEATDSFFQNPDSLHRESMRNAVDKKKLERLYGRYKDPQDENK IGVDGIQQFCDDLSLDPASISVLVIAWKFRAATQCEFSRKEFLDGMTELG CDSMEKLKALLPRLEQELKDTAKFKDFYQFTFTFAKNPGQKGLDLEMAVA YWKLVLSGRFKFLDLWNTFLMEHHKRSIPRDTWNLLLDFGNMIADDMSNY DEEGAWPVLIDDFVEYARPVVTGGKRSLF
    • Molecular weight32 kDa including tags
    • Amino acids1 to 259
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113157 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab113157 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.02% DTT, 30% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names
    • C13orf17
    • DCN1 like protein 2
    • DCN1, defective in cullin neddylation 1, domain containing 2 (S. cerevisiae)
    • DCN1-like protein 2
    • DCNL2_HUMAN
    • DCUN1 domain-containing protein 2
    • DCUN1D2
    • DCUN1L2
    • Defective in cullin neddylation protein 1-like protein 2
    • FLJ10704
    • FLJ20092
    • OTTHUMP00000018776
    see all
  • FunctionMay contribute to neddylation of cullin components of SCF-type E3 ubiquitin ligase complexes. Neddylation of cullins play an essential role in the regulation of SCF-type complexes activity.
  • Sequence similaritiesContains 1 DCUN1 domain.
    Contains 1 UBA-like domain.
  • Information by UniProt

Recombinant Human DCUN1D2 protein images

  • 15% SDS PAGE analysis of 3 µg ab113157.

References for Recombinant Human DCUN1D2 protein (ab113157)

ab113157 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113157.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"