Recombinant Human DCUN1D4 protein (ab161547)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MPPRKKRRPASGDDLSAKKSRHDSMYRKYDSTRIKTEEEAFSSKRCLEWF YEYAGTDDVVGPEGMEKFCEDIGVEPENVVMLVLAWKLDAQNMGYFTLQE WLKGMTSLQCDTTEKLRNTLDYLRSFLNDSTNFKLIYRYAFDFARQSKYK VINKDQWCNVLEFSRTINLDLSNYDEDGAWPVLLDEFVEWYKDKQMS
    • Amino acids
      1 to 197
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161547 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DCN1 like protein 4
    • DCN1, defective in cullin neddylation 1, domain containing 4
    • DCN1, defective in cullin neddylation 1, domain containing 4 (S. cerevisiae)
    • DCN1-like protein 4
    • DCNL4_HUMAN
    • DCUN1 domain containing protein 4
    • DCUN1 domain-containing protein 4
    • DCUN1D 4
    • Dcun1d4
    • Defective in cullin neddylation protein 1-like protein 4
    • KIAA0276
    see all
  • Sequence similarities
    Contains 1 DCUN1 domain.
  • Information by UniProt

Images

  • ab161547 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161547 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161547.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up