Recombinant Human DDAH1 protein (ab99863)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionO94760
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGSMAGLGHPAAFGRATHAVVRALPESLGQ HALRSAKGEEVDVARAERQHQLYVGVLGSKLGLQVVELPADESLPDCVFV EDVAVVCEETALITRPGAPSRRKEVDMMKEALEKLQLNIVEMKDENATLD GGDVLFTGREFFVGLSKRTNQRGAEILADTFKDYAVSTVPVADGLHLKSF CSMAGPNLIAIGSSESAQKALKIMQQMSDHRYDKLTVPDDIAANCIYLNI PNKGHVLLHRTPEEYPESAKVYEKLKDHMLIPVSMSELEKVDGLLTCCSV LINKKVDS
    • Molecular weight34 kDa including tags
    • Amino acids1 to 285
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99863 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab99863 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 50mM Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • DDAH
    • DDAH I
    • DDAH-1
    • DDAH1
    • DDAH1_HUMAN
    • DDAHI
    • Dimethylargininase 1
    • Dimethylargininase-1
    • Dimethylarginine dimethylaminohydrolase 1
    • N(G)
    • N(G)-dimethylarginine dimethylaminohydrolase 1
    • NG NG dimethylarginine dimethylaminohydrolase
    see all
  • FunctionHydrolyzes N(G),N(G)-dimethyl-L-arginine (ADMA) and N(G)-monomethyl-L-arginine (MMA) which act as inhibitors of NOS. Has therefore a role in the regulation of nitric oxide generation.
  • Tissue specificityDetected in brain, liver, kidney and pancreas, and at low levels in skeletal muscle.
  • Sequence similaritiesBelongs to the DDAH family.
  • Information by UniProt

Recombinant Human DDAH1 protein images

  • 15% SDS-PAGE showing ab99863 (3µg).

References for Recombinant Human DDAH1 protein (ab99863)

ab99863 has not yet been referenced specifically in any publications.

Product Wall

Thank you for your response.

I have conducted a search for your customer and found the following products in our catalogue.

ab109090: eNOS/NOS3 - C terminal peptide, though it has not been tested in Western blot application; it was ...

Read More

Thank you for your enquiry and interest in our products.

It depends on some factors such as the position of the tag, the number of copies, the clonality of the antibody etc. It would be also interesting to know in what application the custome...

Read More

Thank you for contacting us.

We have:

DDAH1 protein (http://www.abcam.com/ab99863), Recombinant full length Human DDAH1 (amino acids 1-285) with an N terminal His tag.
DDAH2 protein (Tagged-His Tag) (http://www.abcam.com/ab92017),...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"