Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP35638
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMAAESLPFSFGTLSSWELEAWYEDLQEVLS SDENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEEPEPAEVTSTSQSP HSPDSSQSSLAQEEEEEDQGRTRKRKQSGHSPARAGKQRMKEKEQENERK VAQLAEENERLKQEIERLTREVEATRRALIDRMVNLHQA
    • Molecular weight21 kDa including tags
    • Amino acids1 to 169
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab117195 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Purity> 90 % SDS-PAGE.
    ab117195 is purified by proprietary chromatographic techniques and sterile filtered. Purity greater than 90.0% as determined by analysis by RP-HPLC and analysis by SDS-PAGE.
  • FormLiquid
  • Additional notesFor long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 20% Glycerol, 0.32% Tris HCl

General Info

  • Alternative names
    • C/EBP homologous protein
    • C/EBP Homology Protein
    • C/EBP zeta
    • C/EBP-homologous protein
    • C/EBP-homologous protein 10
    • CCAAT/enhancer binding protein homologous protein
    • CEBPZ
    • CHOP
    • CHOP 10
    • CHOP-10
    • CHOP10
    • DDIT 3
    • DDIT-3
    • Ddit3
    • DDIT3_HUMAN
    • DNA Damage Inducible Transcript 3
    • DNA damage-inducible transcript 3 protein
    • GADD 153
    • GADD153
    • Growth Arrest and DNA Damage Inducible Protein 153
    • Growth arrest and DNA damage inducible protein GADD153
    • Growth arrest and DNA damage-inducible protein GADD153
    • MGC4154
    see all
  • FunctionInhibits the DNA-binding activity of C/EBP and LAP by forming heterodimers that cannot bind DNA.
  • Involvement in diseaseNote=A chromosomal aberration involving DDIT3 is found in a patient with malignant myxoid liposarcoma. Translocation t(12;16)(q13;p11) with FUS.
  • Sequence similaritiesBelongs to the bZIP family.
    Contains 1 bZIP domain.
  • Cellular localizationNucleus.
  • Information by UniProt

References for Recombinant Human DDIT3 protein (ab117195)

ab117195 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab117195.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"