Overview

  • Product name
    Recombinant Human DDT protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMPFLELDTNLPANRVPAGLEKRLCAAAASI LGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGTAEDNRSHSAH FFEFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL
    • Molecular weight
      15 kDa including tags
    • Amino acids
      1 to 118
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab96820 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab96820 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, pH 8.0

General Info

  • Alternative names
    • D dopachrome decarboxylase
    • D dopachrome tautomerase
    • D-dopachrome decarboxylase
    • D-dopachrome tautomerase
    • DDCT
    • Ddt
    • DOPD_HUMAN
    • Phenylpyruvate tautomerase II
    see all
  • Function
    Tautomerization of D-dopachrome with decarboxylation to give 5,6-dihydroxyindole (DHI).
  • Sequence similarities
    Belongs to the MIF family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Recombinant Human DDT protein images

  • 15% SDS-PAGE showing ab96820 at approximately 14.8kDa (3µg).

References for Recombinant Human DDT protein (ab96820)

ab96820 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab96820.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up