Overview

  • Product name
    Recombinant Human DDX10 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGKTANSPGSGARPDPVRSFNRWKKKHSHRQNKKKQLRKQLKKPEWQVER ESISRLMQNYEKINVNEITRFSDFPLSKKTLKGLQEAQYRLVTEIQKQTI GLALQGKDVLGAAKTGSGKTLAFLVPVLEALYRLQWTSTDGLGVLIISPT RELAYQTFEVLRKVGKNHDFSAGLIIGGKDLKHEAERINNINILVCTPGR LLQHMDETVSFHATDLQMLVLDEADRILDMGFADTMNAVIENLPKKRQTL LFSATQTKSVKDLARLSLKNPEYVWVHEKAKYSTPATLEQNYIVCELQQK ISVLYSFLRSHLKKKSIVFFSSCKEVQYLYRVFCRLRPGVSILALHGRQQ QMRRMEVYNEFVRKRAAVLFATDIAARGLDFPAVNWVLQFDCPEDANTYI HRAGRTARYKEDGEALLILLPSEKAMVQQLLQKKVPVKEIKINPEKLIDV QKKLESILAQDQDLKERAQRCFVSYVRSVYLMKDKEVFDVSKLPIPEYAL SLGLAVAPRVRFLQKMQKQPTKELVRSQADKVIEPRAPSLTNDEVEEFRA YFNEKMSILQKGGKRLEGTEHRQDNDTGNEEQEEEEDDEEEMEEKLAKAK GSQAPSLPNTSEAQKIKEVPTQFLDRDEEEEDADFLKVKRHNVFGLDLKD EKTLQKKEPSKSSIKKKMTKVAEAKKVMKRNFKVNKKITFTDEGELVQQW PQMQKSAIKDAEEDDDTGGINLHKAKERLQEEDKFDKEEYRKKIKAKHRE KRLKEREARREANKRQAKAKDEEEAFLDWSDDDDDDDDGFDPSTLPDPDK YRSSEDSDSEDMENKISDTKKKQGMKKRSNSEVEDVGPTSHNRKKARWDT LEPLDTGLSLAEDEELVLHLLRSQS
    • Amino acids
      1 to 875
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158271 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DDX 10
    • DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 10
    • DEAD box protein 10
    • HRH J8
    • Probable ATP dependent RNA helicase DDX10
    see all
  • Relevance
    DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein DDX10.
  • Cellular localization
    Nuclear

Images

  • ab158271 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158271 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158271.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up