Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ92841-3
    • SpeciesHuman
    • SequenceMQLVDHRGGGGGGGKGGRSRYRTTSSANNPNLMYQDECDRRLRGVKDGGR RDSASYRDRSETDRAGYANGSGYGSPNSAFGAQAGQYTYGQGTYGAAAYG TSSYTAQEYGAGTYGASSTTSTGRSSQSSSQQFSGIGRSGQQPQPLMSQQ FAQPPGATNMIGYMGQTAYQYPPPPPPPPPSRK
    • Molecular weight46 kDa including tags
    • Amino acids470 to 652
    • TagsGST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112392 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • FormLiquid
  • Additional notesBest to use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione

General Info

  • Alternative names
    • Ddx17
    • DDX17_HUMAN
    • DEAD (Asp Glu Ala Asp) box helicase 17
    • DEAD (Asp Glu Ala Asp) box polypeptide 17
    • DEAD box helicase 17
    • DEAD box protein 17
    • DEAD box protein p72
    • DEAD/H (Asp Glu Ala Asp/His) box polypeptide 17
    • P72
    • Probable ATP-dependent RNA helicase DDX17
    • RH70
    • RNA dependent helicase p72
    • RNA-dependent helicase p72
    see all
  • FunctionRNA-dependent ATPase activity.
  • Tissue specificityUbiquitous.
  • Sequence similaritiesBelongs to the DEAD box helicase family. DDX5/DBP2 subfamily.
    Contains 1 helicase ATP-binding domain.
    Contains 1 helicase C-terminal domain.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human DDX17 protein images

  • 12.5% SDS-PAGE analysis of ab112392. Stained with Coomassie Blue.

References for Recombinant Human DDX17 protein (ab112392)

ab112392 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112392.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"