Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MQLVDHRGGGGGGGKGGRSRYRTTSSANNPNLMYQDECDRRLRGVKDGGR RDSASYRDRSETDRAGYANGSGYGSPNSAFGAQAGQYTYGQGTYGAAAYG TSSYTAQEYGAGTYGASSTTSTGRSSQSSSQQFSGIGRSGQQPQPLMSQQ FAQPPGATNMIGYMGQTAYQYPPPPPPPPPSRK
    • Molecular weight
      46 kDa including tags
    • Amino acids
      470 to 652
    • Tags
      GST tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab112392 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Best to use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione

General Info

  • Alternative names
    • Ddx17
    • DDX17_HUMAN
    • DEAD (Asp Glu Ala Asp) box helicase 17
    • DEAD (Asp Glu Ala Asp) box polypeptide 17
    • DEAD box helicase 17
    • DEAD box protein 17
    • DEAD box protein p72
    • DEAD/H (Asp Glu Ala Asp/His) box polypeptide 17
    • P72
    • Probable ATP-dependent RNA helicase DDX17
    • RH70
    • RNA dependent helicase p72
    • RNA-dependent helicase p72
    see all
  • Function
    RNA-dependent ATPase activity.
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Belongs to the DEAD box helicase family. DDX5/DBP2 subfamily.
    Contains 1 helicase ATP-binding domain.
    Contains 1 helicase C-terminal domain.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab112392. Stained with Coomassie Blue.

References

ab112392 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab112392.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up