Overview

  • Product name
    Recombinant Human DDX21 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MPGKLRSDAGLESDTAMKKGETLRKQTEEKEKKEKPKSDKTEEIAEEEET VFPKAKQVKKKAEPSEVDMNSPKSKKAKKKEEPSQNDISPKTKSLRKKKE PIEKKVVSSKTKKVTKNEEPSEEEIDAPKPKKMKKEKEMNGETREKSPKL KNGFPHPEPDCNPSEAASEESNSEIEQEIPVEQKEGAFSNFPISEETIKL LKGRGVTFLFPIQAKTFHHVYSGKDLIAQARTGTGKTFSFAIPLIEKLHG ELQDRKRGRAPQVLVLAPTRELANQVSKDFSDITKKLSVACFYGGTPYGG QFERMRNGIDILVGTPGRIKDHIQNGKLDLTKLKHVVLDEVDQMLDMGFA DQVEEILSVAYKKDSEDNPQTLLFSATCPHWVFNVAKKYMKSTYEQVDLI GKKTQKTAITVEHLAIKCHWTQRAAVIGDVIRVYSGHQGRTIIFCETKKE AQELSQNSAIKQDAQSLHGDIPQKQREITLKGFRNGSFGVLVATNVAARG LDIPEVDLVIQSSPPKDVESYIHRSGRTGRAGRTGVCICFYQHKEEYQLV QVEQKAGIKFKRIGVPSATEIIKASSKDAIRLLDSVPPTAISHFKQSAEK LIEEKGAVEALAAALAHISGATSVDQRSLINSNVGFVTMILQCSIEMPNI SYAWKELKEQLGEEIDSKVKGMVFLKGKLGVCFDVPTASVTEIQEKWHDS RRWQLSVATEQPELEGPREGYGGFRGQREGSRGFRGQRDGNRRFRGQREG SRGPRGQRSGGGNKSNRSQNKGQKRSFSKAFGQ
    • Amino acids
      1 to 783
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152960 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Ddx21
    • DDX21_HUMAN
    • DEAD (Asp-Glu-Ala-Asp) box helicase 21
    • DEAD (Asp-Glu-Ala-Asp) box polypeptide 21
    • DEAD box protein 21
    • EC 3.6.1.-
    • Gu alpha
    • Gu protein
    • Gu-alpha
    • GUA
    • GURDB
    • Nucleolar RNA helicase 2
    • Nucleolar RNA helicase Gu
    • Nucleolar RNA helicase II
    • RH II/Gu
    • RH II/GuA
    • RNA helicase II/Gu alpha
    see all
  • Function
    Can unwind double-stranded RNA (helicase) and can fold or introduce a secondary structure to a single-stranded RNA (foldase). Functions as cofactor for JUN-activated transcription. Involved in rRNA processing.
  • Sequence similarities
    Belongs to the DEAD box helicase family. DDX21/DDX50 subfamily.
    Contains 1 helicase ATP-binding domain.
    Contains 1 helicase C-terminal domain.
  • Domain
    The two enzymatic activities reside in two separate domains, the helicase in the N-terminus and the foldase in the C-terminus.
    The 3 X 5 AA repeats seem to be critical for the RNA folding activity.
  • Cellular localization
    Nucleus > nucleolus.
  • Information by UniProt

Images

  • ab152960 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab152960 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152960.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up