Overview

  • Product name
    Recombinant Human DDX26 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      DKEQCAEENIPASSLNKGKKLMHCRSHEEVNTELKAQIMKEIRKPGRKYE RIFTLLKHVQGSLQTRLIFLQNVIKEASRFKKRMLIEQLENFLDEIHRRA NQINHINSN
    • Amino acids
      779 to 887
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161992 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DBI 1
    • DBI-1
    • DBI1
    • DDX26
    • DDX26A
    • DEAD box protein
    • DEAD/H (Asp Glu Ala Asp/His) box polypeptide 26
    • Deleted in cancer 1
    • DICE1
    • DKFZp434B105
    • HDB
    • Int6
    • INT6_HUMAN
    • Integrator complex subunit 6
    • INTS 6
    • ints6
    • Notchl2
    • OTTHUMP00000018439
    • OTTHUMP00000215034
    • OTTHUMP00000215036
    • Protein DDX26
    • Protein deleted in cancer 1
    • RNA helicase HDB
    see all
  • Function
    Component of the Integrator complex, a complex involved in the small nuclear RNAs (snRNA) U1 and U2 transcription and in their 3'-box-dependent processing. The Integrator complex is associated with the C-terminal domain (CTD) of RNA polymerase II largest subunit (POLR2A) and is recruited to the U1 and U2 snRNAs genes. May have a tumor suppressor role; an ectopic expression suppressing tumor cell growth.
  • Tissue specificity
    Widely expressed. Expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas.
  • Sequence similarities
    Belongs to the Integrator subunit 6 family.
    Contains 1 VWFA domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab161992 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161992 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161992.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up