Overview

  • Product name
    Recombinant Human DDX28 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MALARPVRLFSLVTRLLLAPRRGLTVRSPDEPLPVVRIPVALQRQLEQRQ SRRRNLPRPVLVRPGPLLVSARRPELNQPARLTLGRWERAPLASQGWKSR RARRDHFSIERAQQEAPAVRKLSSKGSFADLGLEPRVLHALQEAAPEVVQ PTTVQSSTIPSLLRGRHVVCAAETGSGKTLSYLLPLLQRLLGQPSLDSLP IPAPRGLVLVPSRELAQQVRAVAQPLGRSLGLLVRDLEGGHGMRRIRLQL SRQPSADVLVATPGALWKALKSRLISLEQLSFLVLDEADTLLDESFLELV DYILEKSHIAEGPADLEDPFNPKAQLVLVGATFPEGVGQLLNKVASPDAV TTITSSKLHCIMPHVKQTFLRLKGADKVAELVHILKHRDRAERTGPSGTV LVFCNSSSTVNWLGYILDDHKIQHLRLQGQMPALMRVGIFQSFQKSSRDI LLCTDIASRGLDSTGVELVVNYDFPPTLQDYIHRAGRVGRVGSEVPGTVI SFVTHPWDVSLVQKIELAARRRRSLPGLASSVKEPLPQAT
    • Amino acids
      1 to 540
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163225 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DDX 28
    • DDX28
    • DDX28_HUMAN
    • DEAD (Asp Glu Ala Asp) box polypeptide 28
    • DEAD box polypeptide 28
    • DEAD/H (Asp Glu Ala Asp/His) box polypeptide 28
    • FLJ11282
    • MDDX 28
    • MDDX28
    • Mitochondrial DEAD box protein 28
    • Probable ATP-dependent RNA helicase DDX28
    see all
  • Function
    May be involved in RNA processing or transport. Has RNA and Mg(2+)-dependent ATPase activity.
  • Tissue specificity
    Expressed in all tissues tested, including brain, placenta, lung, liver, skeletal muscle, kidney, pancreas, leukocytes, colon, small intestine, ovary and prostate.
  • Sequence similarities
    Belongs to the DEAD box helicase family.
    Contains 1 helicase ATP-binding domain.
    Contains 1 helicase C-terminal domain.
  • Cellular localization
    Nucleus. Mitochondrion. Transported between these two compartments. Nuclear localization depends on active RNA polymerase II transcription.
  • Information by UniProt

Images

  • ab163225 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163225 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163225.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up