Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSHVAVENALGLDQQFAGLDLNSSDNQSGGSTASKGRYIPPHLRNREATK GFYDKDSSGWSSSKDKDAYSSFGSRSDSRGKSSFFSDRGSGSRGRFDDRG RSDYDGIGSRGDRSGFGKFERGGNSRWCDKSDEDDWSKPLPPSERLEQEL FSGGNTGINFEKYDDIPVEATGNNCPPHIESFSDVEMGEIIMGNIELTRY TRPTPVQKHAIPIIKEKRDLMACAQTGSGKTAAFLLPILSQIYSDGPGEA LRAMKENGRYGRRKQYPISLVLAPTRELAVQIYEEARKFSYRSRVRPCVV YGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEAD RMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEY IFLAVGRVGSTSENITQKVVWVEESDKRSFLLDLLNATGKDSLTLVFVET KKGADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAV AARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNERNI NITKDLLDLLVEAKQEVPSWLENMAYEHHYKGSSRGRSKSSRFSGGFGAR DYRQSSGASSSSFSSSRASSSRSGGGGHGSSRGFGGGGYGGFYNSDGYGG NYNSQGVDWWGN
    • Molecular weight
      100 kDa including tags
    • Amino acids
      1 to 662

Specifications

Our Abpromise guarantee covers the use of ab152330 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ATP dependent RNA helicase DDX3X
    • ATP-dependent RNA helicase DDX3X
    • CAP Rf
    • DBX
    • DDX14
    • DDX3X
    • DDX3X_HUMAN
    • DEAD (Asp Glu Ala Asp) box polypeptide 3 X linked
    • DEAD (Asp-Glu-Ala-Asp) box helicase 3, X-linked
    • DEAD box
    • DEAD box protein 3
    • DEAD box protein 3 X-chromosomal
    • DEAD box X isoform
    • DEAD box, X isoform
    • DEAD/H (Asp Glu Ala Asp/His) box polypeptide 3
    • DEAD/H box 3
    • DEAD/H box 3, X-linked
    • Helicase like protein 2
    • Helicase-like protein 2
    • HLP2
    • X isoform
    • X-chromosomal
    see all
  • Function
    ATP-dependent RNA helicase. Acts as a cofactor for XPO1-mediated nuclear export of incompletely spliced HIV-1 Rev RNAs. Also involved in HIV-1 replication. Interacts specifically with hepatitis C virus core protein resulting in a change in intracellular location.
  • Sequence similarities
    Belongs to the DEAD box helicase family. DDX3/DED1 subfamily.
    Contains 1 helicase ATP-binding domain.
    Contains 1 helicase C-terminal domain.
  • Cellular localization
    Nucleus speckle. Cytoplasm. Located predominantly in nuclear speckles and, at low levels, throughout the cytoplasm. Located to the outer side of nuclear pore complexes (NPC). Shuttles between the nucleus and the cytoplasm in a XPO1-dependent manner.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152330 stained with Coomassie Blue.

References

ab152330 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152330.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up