Recombinant Human DDX39 protein (denatured) (ab181916)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSEFMAEQDVENDLLDYDEEEEPQAPQES TPAPPKKDIKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECI PQAILGMDVLCQAKSGMGKTAVFVLATLQQ IEPVNGQVTVLVMCHTRELAFQISKEYERFSKYMPSVKVSVFFGGLSIKK DEEVLKKNCPHVVVGTPGRILALVRNRSFSLKNVKHFVLDECDKMLEQLD MRRDVQEIFRLTPHEKQCMMFSATLSKDIRPVCRKFMQDPMEVF
    • Molecular weight
      31 kDa including tags
    • Amino acids
      1 to 249
    • Tags
      His tag N-Terminus
    • Additional sequence information
      NP_005795.

Specifications

Our Abpromise guarantee covers the use of ab181916 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 80 % SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.32% Tris HCl, 10% Glycerol, 2.4% Urea

General Info

  • Alternative names
    • ATP dependent RNA helicase DDX39
    • ATP-dependent RNA helicase DDX39A
    • BAT1
    • BAT1L
    • DDX39
    • DDXL
    • DEAD (Asp-Glu-Ala-Asp) box polypeptide 39 isoform 2
    • DEAD (Asp-Glu-Ala-Asp) box polypeptide 39A
    • DEAD box protein 39
    • DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 39
    • Eukaryotic initiation factor 4a
    • Nuclear RNA helicase URH49
    • Nuclear RNA helicase, DECD variant of DEAD box family
    • UAP56 related helicase
    • UAP56 related helicase, 49 kDa
    • URH49
    • wu:fc87b12
    • zgc:55881
    see all
  • Relevance
    DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of the DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DDX39 encodes a member of this family. The function of this member has not been determined. Alternative splicing of this gene generates 2 transcript variants encoding different isoforms.
  • Cellular localization
    Cytoplasmic and Nuclear

Images

  • 15% SDS-PAGE analysis of ab181916 (3µg).

References

ab181916 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab181916.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up