Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSHVVVKNDPELDQQLANLDLNSEKQSGGASTASKGRYIPPHLRNREASK GFHDKDSSGWSCSKDKDAYSSFGSRDSRGKPGYFSERGSGSRGRFDDRGR SDYDGIGNRERPGFGRFERSGHSRWCDKSVEDDWSKPLPPSERLEQELFS GGNTGINFEKYDDIPVEATGSNCPPHIENFSDIDMGEIIMGNIELTRYTR PTPVQKHAIPIIKGKRDLMACAQTGSGKTAAFLLPILSQIYTDGPGEALK AVKENGRYGRRKQYPISLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYG GADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRM LDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYIF LAVGRVGSTSENITQKVVWVEDLDKRSFLLDILGATGSDSLTLVFVETKK GADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAA RGLDISNVRHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNEKNMNI TKDLLDLLVEAKQEVPSWLENMAYEHHYKGGSRGRSKSNRFSGGFGARDY RQSSGSSSSGFGASRGSSSRSGGGGYGNSRGFGGGGYGGFYNSDGYGGNY NSQGVDWWGN
    • Amino acids
      1 to 660
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160136 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ATP dependent RNA helicase DDX3Y
    • ATP-dependent RNA helicase DDX3Y
    • DBY
    • DDX3Y
    • DDX3Y_HUMAN
    • DEAD (Asp-Glu-Ala-Asp) box polypeptide 3 Y linked
    • DEAD box protein 3
    • DEAD box protein 3 Y chromosomal
    • DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide Y chromosome
    • Y-chromosomal
    see all
  • Function
    Probable ATP-dependent RNA helicase. May play a role in spermatogenesis.
  • Tissue specificity
    Testis-specific. Expressed predominantly in spermatogonia.
  • Involvement in disease
    Note=DDX3Y is located in the 'azoospermia factor a' (AZFa) region on chromosome Y which is deleted in Sertoli cell-only syndrome. This is an infertility disorder in which no germ cells are visible in seminiferous tubules leading to azoospermia.
  • Sequence similarities
    Belongs to the DEAD box helicase family. DDX3/DED1 subfamily.
    Contains 1 helicase ATP-binding domain.
    Contains 1 helicase C-terminal domain.
  • Cellular localization
    Cytoplasm. Nucleus. Shuttles between the nucleus and the cytoplasm in an XPO1-dependent manner.
  • Information by UniProt

Images

  • ab160136 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160136 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160136.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up