Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      TGRSGNTGIATTFINKACDESVLMDLKALLLEAKQKVPPVLQVLHCGDES MLDIGGERGCAFCGGLGHRITDCPKLEAMQTKQVSNIGRKDYLAHSSMDF
    • Amino acids
      523 to 622
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162547 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2900024F02Rik
    • AA958953
    • ABS
    • AI324246
    • Ddx41
    • DDX41_HUMAN
    • DEAD (Asp-Glu-Ala-Asp) box polypeptide 41
    • DEAD box protein 41
    • DEAD box protein abstrakt
    • DEAD box protein abstrakt homolog
    • EC 3.6.1.-
    • fb92e02
    • MGC55896
    • MGC8828
    • Probable ATP-dependent RNA helicase DDX41
    • Putative RNA helicase
    • wu:fb92e02
    • zgc:55896
    see all
  • Function
    Probable ATP-dependent RNA helicase. Is required during post-transcriptional gene expression. May be involved in pre-mRNA splicing.
  • Sequence similarities
    Belongs to the DEAD box helicase family. DDX41 subfamily.
    Contains 1 CCHC-type zinc finger.
    Contains 1 helicase ATP-binding domain.
    Contains 1 helicase C-terminal domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab162547 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162547 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162547.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up