Overview

  • Product name
    Recombinant Human DDX53 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSHWAPEWKRAEANPRDLGASWDVRGSRGSGWSGPFGHQGPRAAGSREPP LCFKIKNNMVGVVIGYSGSKIKDLQHSTNTKIQIINGESEAKVRIFGNRE MKAKAKAAIETLIRKQESYNSESSVDNAASQTPIGRNLGRNDIVGEAEPL SNWDRIRAAVVECEKRKWADLPPVKKNFYIESKATSCMSEMQVINWRKEN FNITCDDLKSGEKRLIPKPTCRFKDAFQQYPDLLKSIIRVGILKPTPIQS QAWPIILQGIDLIVVAQTGTGKTLSYLMPGFIHLDSQPISREQRNGPGML VLTPTRELALHVEAECSKYSYKGLKSICIYGGRNRNGQIEDISKGVDIII ATPGRLNDLQMNNSVNLRSITYLVIDEADKMLDMEFEPQIRKILLDVRPD RQTVMTSATWPDTVRQLALSYLKDPMIVYVGNLNLVAVNTVKQNIIVTTE KEKRALTQEFVENMSPNDKVIMFVSQKHIADDLSSDFNIQGISAESLHGN SEQSDQERAVEDFKSGNIKILITTDIVSRGLDLNDVTHVYNYDFPRNIDV YVHRVGYIGRTGKTGTSVTLITQRDSKMAGELIKILDRANQSVPEDLVVM AEQYKLNQQKRHRETRSREPGQRRKEFYFLS
    • Amino acids
      1 to 631
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165799 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CAGE
    • Cancer associated gene protein
    • Cancer-associated gene protein
    • Cancer/testis antigen 26
    • CT26
    • DDX53
    • DDX53_HUMAN
    • DEAD (Asp Glu Ala Asp) box polypeptide 53
    • DEAD box protein 53
    • DEAD box protein CAGE
    • Probable ATP dependent RNA helicase DDX53
    • Probable ATP-dependent RNA helicase DDX53
    see all
  • Tissue specificity
    Expressed in testis. Wide expression in various cancer tissues and cancer cell lines.
  • Sequence similarities
    Belongs to the DEAD box helicase family.
    Contains 1 helicase ATP-binding domain.
    Contains 1 helicase C-terminal domain.
    Contains 1 KH domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab165799 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165799 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165799.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up