Overview

  • Product name
    Recombinant Human DDX54 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      DDRDSDEEGASDRRGPERRGGKRDRGQGASRPHAPGTPAGRVRPELKTKQ QILKQRRRAQKLHFLQRGGLKQLSARNRRRVQELQQGAFGRGARSKKGKM RKRM
    • Amino acids
      778 to 881
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163967 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2410015A15Rik
    • AI414901
    • ATP dependent RNA helicase DDX54
    • ATP-dependent RNA helicase DDX54
    • ATP-dependent RNA helicase DP97
    • DDX54
    • DDX54_HUMAN
    • DEAD (Asp-Glu-Ala-Asp) box polypeptide 54
    • DEAD box helicase 54
    • DEAD box protein 54
    • DEAD box RNA helicase 97 kDa
    • DP97
    • MGC2835
    • RGD1562539
    see all
  • Function
    Has RNA-dependent ATPase activity. Represses the transcriptional activity of nuclear receptors.
  • Sequence similarities
    Belongs to the DEAD box helicase family. DDX54/DBP10 subfamily.
    Contains 1 helicase ATP-binding domain.
    Contains 1 helicase C-terminal domain.
  • Cellular localization
    Nucleus > nucleolus.
  • Information by UniProt

Images

  • ab163967 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163967 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163967.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up