Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP26196
    • SpeciesHuman
    • SequenceMSTARTENPVIMGLSSQNGQLRGPVKPTGGPGGGGTQTQQQMNQLKNTNT INNGTQQQAQSMTTTIKPGDDWKKTLKLPPKDLRIKTSDVTSTKGNEFED YCLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAY LIPLLERLDLKKDNIQAMVIVPTRELALQVSQICIQVSKHMGGAKVMATT GGTNLRDDIMRLDDTVHVVIATPGRILDLIKKGVAKVDHVQMIVLDEADK LLSQDFVQIMEDIILTLPKNRQILLYSATFPLSVQKFMNSHLQKPYEINL MEELTLKGVTQYYAYVTERQKVHCLNTLFSRLQINQSIIFCNSSQRVELL AKKISQLGYSCFYIHAKMRQEHRNRVFHDFRNGLCRNLVCTDLFTRGIDI QAVNVVINFDFPKLAETYLHRIGRSGRFGHLGLAINLITYDDRFNLKSIE EQLGTEIKPIPSNIDKSLYVAEYHSEPVEDEKP
    • Molecular weight79 kDa
    • Amino acids1 to 483
    • TagsGST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab114574 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ATP dependent RNA helicase DDX6
    • ATP dependent RNA helicase p54
    • DDX6
    • DEAD (Asp Glu Ala Asp) box polypeptide 6
    • DEAD box 6
    • DEAD box protein 6
    • DEAD/H (Asp Glu Ala Asp/His) box polypeptide 6 (RNA helicase 54kD)
    • FLJ36338
    • HLR2
    • Oncogene RCK
    • P54
    • Probable ATP-dependent RNA helicase DDX6
    • RCK
    see all
  • RelevanceDEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis and cellular growth and division. In the process of mRNA degradation, DDX6 may play a role in mRNA decapping. It forms a complex with DCP1A, DCP2, EDC3 and EDC4/HEDLS.
  • Cellular localizationCytoplasm; P-body. Note: Processing bodies (PB).

Recombinant Human DDX6 protein images

  • 12.5% SDS-PAGE Stained with Coomassie Blue

References for Recombinant Human DDX6 protein (ab114574)

ab114574 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114574.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"