Recombinant human Decorin protein (ab167743)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      GPFQQRGLFDFMLEDEASGIGPEVPDDRDFEPSLGPVCPFRCQCHLRVVQ CSDLGLDKVPKDLPPDTTLLDLQN NKITEIKDGDFKNLKNLHALILVN NKISKVSPGAFTPLVKLERLYLSKNQLKELPEKMPKTLQELRAHENEITK VRKVTFNGLNQMIVIELGTNPLKSSGIENGAFQGMKKLSYIRIADTNITS IPQGLPPSLTELHLDGNKISRVDAASLKGLNNLAKLGLSFNSISAVDNGS LANTPHLRELHLDNNKLTRVPGGLAEHKYIQVVYLHNNNISVVGSSDFCP PGHNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVRSAIQLGNYK
    • Molecular weight
      39 kDa including tags
    • Amino acids
      17 to 359
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab167743 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Measured by its ability to modulate collagen fibrillogenesis. At 5 µg/mL, rhDecorin can significantly delay the rate of type I collagen fibrillogenesis.
  • Applications

    SDS-PAGE

    Functional Studies

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    ab167743 was lyophilized from 0.22 µm filtered solution.
  • Form
    Lyophilised
  • Additional notes
    Measured by its ability to modulate collagen fibrillogenesis. At 5 µg/mL, rhDecorin can significantly delay the rate of type I collagen fibrillogenesis.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 94% PBS, 5% Trehalose

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 1mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names
    • Bone proteoglycan II
    • CSCD
    • DCN
    • DCN protein
    • Decorin
    • Decorin proteoglycan
    • Dermatan sulphate proteoglycans II
    • DKFZp686J19238
    • DSPG 2
    • DSPG2
    • PG 40
    • PG II
    • PG S2
    • PG-S2
    • PG40
    • PGII
    • PGS 2
    • PGS2
    • PGS2_HUMAN
    • Proteoglycan core protein
    • SLRR1B
    • Small leucine rich protein 1B
    see all
  • Function
    May affect the rate of fibrils formation.
  • Involvement in disease
    Defects in DCN are the cause of congenital stromal corneal dystrophy (CSCD) [MIM:610048]. Corneal dystrophies are inherited, bilateral, primary alterations of the cornea that are not associated with prior inflammation or secondary to systemic disease. Most show autosomal dominant inheritance.
  • Sequence similarities
    Belongs to the small leucine-rich proteoglycan (SLRP) family. SLRP class I subfamily.
    Contains 12 LRR (leucine-rich) repeats.
  • Post-translational
    modifications
    The attached glycosaminoglycan chain can be either chondroitin sulfate or dermatan sulfate depending upon the tissue of origin.
  • Cellular localization
    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt

Images

  • SDS-PAGE analysis of reduced ab167743 and staining overnight with Coomassie Blue.
    Protein migrates as 45 kDa or higher due to different glycosylation.

References

ab167743 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167743.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up