Recombinant human Decorin protein (ab169898)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MASMTGGQQMGRGHHHHHHGNLYFQGGEFEASGIGPEVPDDRDFEPSLGP VCPFRCQCHLRVVQCSDLGLDKVPKDLPPDTTLLDLQNNKITEIKDGDFK NLKNLHALILVNNKISKVSPGAFTPLVKLERLYLSKNQLKELPEKMPKTL QELRAHENEITKVRKVTFNGLNQMIVIELGTNPLKSSGIENGAFQGMKKL SYIRIADTNITSIPQGLPPSLTELHLDGNKISRVDAASLKGLNNLAKLGL SFNSISAVDNGSLANTPHLRELHLDNNKLTRVPGGLAEHKYIQVVYLHNN NISVVGSSDFCPPGHNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVRSA IQLGNYK
    • Molecular weight
      39 kDa including tags
    • Amino acids
      31 to 359
    • Tags
      His-T7 tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab169898 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Coating ab169898 at 5-10 µg / well (6 well plate) in a specific culture medium may be used for studying Human cells activation / differentiation in vitro.
  • Applications

    SDS-PAGE

    Functional Studies

  • Purity
    >90% by SDS-PAGE.
    ab169898 was expressed in E.coli as inclusion bodies, then refolded using “temperature shift inclusion body refolding” technology, chromatographically purified and sterile-filtered.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituent: 0.32% Tris HCl
    Note: Contains NaCl, KCl, EDTA, arginine, DTT and glycerol.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • Bone proteoglycan II
    • CSCD
    • DCN
    • DCN protein
    • Decorin
    • Decorin proteoglycan
    • Dermatan sulphate proteoglycans II
    • DKFZp686J19238
    • DSPG 2
    • DSPG2
    • PG 40
    • PG II
    • PG S2
    • PG-S2
    • PG40
    • PGII
    • PGS 2
    • PGS2
    • PGS2_HUMAN
    • Proteoglycan core protein
    • SLRR1B
    • Small leucine rich protein 1B
    see all
  • Function
    May affect the rate of fibrils formation.
  • Involvement in disease
    Defects in DCN are the cause of congenital stromal corneal dystrophy (CSCD) [MIM:610048]. Corneal dystrophies are inherited, bilateral, primary alterations of the cornea that are not associated with prior inflammation or secondary to systemic disease. Most show autosomal dominant inheritance.
  • Sequence similarities
    Belongs to the small leucine-rich proteoglycan (SLRP) family. SLRP class I subfamily.
    Contains 12 LRR (leucine-rich) repeats.
  • Post-translational
    modifications
    The attached glycosaminoglycan chain can be either chondroitin sulfate or dermatan sulfate depending upon the tissue of origin.
  • Cellular localization
    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt

References

ab169898 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab169898.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up