Overview

  • Product name
    Recombinant Human DECR1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHM NTEALQSKFFSPLQKAMLPPNSFQGKVAFITGGGTGLGKGMTTLLSSLGA QCVIASRKMDVLKATAEQISSQTGNKVHAIQCDVRDPDMVQNTVSELIKV AGHPNIVINNAAGNFISPTERLSPNAWKTITDIVLNGTAFVTLEIGKQLI KAQKGAAFLSITTIYAETGSGFVVPSASAKAGVEAMSKSLAAEWGKYGMR FNVIQPGPIKTKGAFSRLDPTGTFEKEMIGRIPCGRLGTVEELANLAAFL CSDYASWINGAVIKFDGGEEVLISGEFNDLRKVTKEQWDTIEELIRKTKG S
    • Molecular weight
      34 kDa including tags
    • Amino acids
      35 to 335
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab105597 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab105597 was purified by using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20mM Tris pH 7.5, 2mM EDTA.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • 1200012F07Rik
    • 2
    • 2,4 dienoyl CoA reductase [NADPH]
    • 2,4 dienoyl CoA reductase 1
    • 2,4 dienoyl CoA reductase mitochondrial
    • 2,4-dienoyl-CoA reductase, mitochondrial
    • 4 enoyl CoA reductase
    • 4-dienoyl-CoA reductase [NADPH]
    • 4-enoyl-CoA reductase [NADPH]
    • DECR
    • DECR 1
    • DECR_HUMAN
    • DECR1
    • Nadph
    • OTTMUSP00000004962
    • RP23-338J24.3
    • SDR18C1
    • Short chain dehydrogenase/reductase family 18C member 1
    see all
  • Function
    Auxiliary enzyme of beta-oxidation. It participates in the metabolism of unsaturated fatty enoyl-CoA esters having double bonds in both even- and odd-numbered positions. Catalyzes the NADP-dependent reduction of 2,4-dienoyl-CoA to yield trans-3-enoyl-CoA.
  • Tissue specificity
    Heart = liver = pancreas > kidney >> skeletal muscle = lung.
  • Sequence similarities
    Belongs to the short-chain dehydrogenases/reductases (SDR) family. 2,4-dienoyl-CoA reductase subfamily.
  • Cellular localization
    Mitochondrion.
  • Information by UniProt

Recombinant Human DECR1 protein images

  • 15% SDS-PAGE analysis of 3µg ab105597.

References for Recombinant Human DECR1 protein (ab105597)

ab105597 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab105597.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up