Overview

  • Product name
    Recombinant Human DECR2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMAQPPPDVEGDDCLPAYRHLFCPDLLR DKVAFITGGGSGIGFRIAEIFMRHGCHTVIASRSLPRVLTAARKLAGATG RRCLPLSMDVRAPPAVMAAVDQALKEFGRIDILINCAAGNFLCPAGALSF NAFKTVMDIDTSGTFNVSRVLYEKFFRDHGGVIVNITATLGNRGQALQVH AGSAKAAVDAMTRHLAVEWGPQNIRVNSLAPGPISGTEGLRRLGGPQASL STKVTASPLQRLGNKTEIAHSVLYLASPLASYVTGAVLVADGGAWLTFPN GVKGLPDFASFSAKL
    • Molecular weight
      33 kDa including tags
    • Amino acids
      1 to 292
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab116178 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab116178 was purified using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 40% Glycerol, 0.88% Sodium chloride, 0.02% DTT

General Info

  • Alternative names
    • 2
    • 2 4 dienoyl CoA reductase 2
    • 2 4 dienoyl CoA reductase 2 peroxisomal
    • 4-dienoyl-CoA reductase
    • 4-dienoyl-CoA reductase 2
    • DECR 2
    • Decr2
    • DECR2_HUMAN
    • EC 1.3.1.34
    • pDCR
    • Peroxisomal 2
    • Peroxisomal 2 4 dienoyl CoA reductase
    • SDR17C1
    • Short chain dehydrogenase/reductase family 17C member 1
    see all
  • Function
    Auxiliary enzyme of beta-oxidation. Participates in the degradation of unsaturated fatty enoyl-CoA esters having double bonds in both even- and odd-numbered positions in peroxisome. Catalyzes the NADP-dependent reduction of 2,4-dienoyl-CoA to yield trans-3-enoyl-CoA. Has activity towards short and medium chain 2,4-dienoyl-CoAs, but also towards 2,4,7,10,13,16,19-docosaheptaenoyl-CoA, suggesting that it does not constitute a rate limiting step in the peroxisomal degradation of docosahexaenoic acid.
  • Sequence similarities
    Belongs to the short-chain dehydrogenases/reductases (SDR) family. 2,4-dienoyl-CoA reductase subfamily.
  • Cellular localization
    Peroxisome.
  • Information by UniProt

Recombinant Human DECR2 protein images

  • 15% SDS-PAGE gel analysis of 3 µg ab116178.

References for Recombinant Human DECR2 protein (ab116178)

ab116178 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116178.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up